BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0681 (673 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6010| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) 28 6.0 >SB_6010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 36.3 bits (80), Expect = 0.022 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +2 Query: 194 SGKTRKLLSKSEATAI*LTD*ILYQSRTNPSGT*TGKPMRL*EKDPKPSSKDRT-ILSIE 370 SGK R LL +A + +L+Q T +G + KP R+ D KPS+ RT +L Sbjct: 346 SGKNRILLCTKTNSAADIHVELLHQYLTEENGIRSAKPFRIYGSDRKPSTCSRTGLLYSN 405 Query: 371 INKGK 385 +N GK Sbjct: 406 LNSGK 410 >SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1918 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 178 LLSNRFGEDEEAPIEVRGDGNLINRLNSL 264 +L N FG EE +E + + +I R+N L Sbjct: 343 VLDNSFGSQEEIVVEAKKEAEVIKRVNEL 371 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,995,317 Number of Sequences: 59808 Number of extensions: 393381 Number of successful extensions: 810 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -