BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0680 (746 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 25 0.85 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.0 DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 21 7.9 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 407 IIYFNILYDLETFFYCLVK-IVYTQRSFVSIVSI 309 ++Y ILY LE+ Y + K +V T F+ + I Sbjct: 268 VVYVLILYILESLLYMVTKLVVVTFLKFIKKIQI 301 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 535 VYYIIFSILYSLVKCVLVM*YSIKLKSGFSGLEIFK 642 + YI+ S+LY + K V+V K G+ I K Sbjct: 273 ILYILESLLYMVTKLVVVTFLKFIKKIQIFGIMITK 308 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 318 CKHSSGTKPSFKHSLGVFLS 259 C S KP+F H L VF + Sbjct: 154 CFFKSSKKPAFSHFLIVFFT 173 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 318 CKHSSGTKPSFKHSLGVFLS 259 C S KP+F H L VF + Sbjct: 154 CFFKSSKKPAFSHFLIVFFT 173 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 318 CKHSSGTKPSFKHSLGVFLS 259 C S KP+F H L VF + Sbjct: 154 CFFKSSKKPAFSHFLIVFFT 173 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 318 CKHSSGTKPSFKHSLGVFLS 259 C S KP+F H L VF + Sbjct: 154 CFFKSSKKPAFSHFLIVFFT 173 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 406 ILNNFIKCLVHE 441 +L N+IKCL+ E Sbjct: 41 VLTNYIKCLMDE 52 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,946 Number of Sequences: 336 Number of extensions: 3400 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -