BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0680 (746 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC047722-1|AAH47722.1| 74|Homo sapiens hypothetical protein MG... 61 4e-09 AC010134-2|AAX93231.1| 74|Homo sapiens unknown protein. 61 4e-09 >BC047722-1|AAH47722.1| 74|Homo sapiens hypothetical protein MGC52110 protein. Length = 74 Score = 61.3 bits (142), Expect = 4e-09 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +2 Query: 257 KDKKTPRECLKDGLVPEECLQLRQSFFECKRSLLDNRRRFRGHKGY 394 ++ K+PR+CLK+G C L+ +FFECKRS+LDNR RFRG KGY Sbjct: 33 QEGKSPRQCLKEGY----CNSLKYAFFECKRSVLDNRARFRGRKGY 74 >AC010134-2|AAX93231.1| 74|Homo sapiens unknown protein. Length = 74 Score = 61.3 bits (142), Expect = 4e-09 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +2 Query: 257 KDKKTPRECLKDGLVPEECLQLRQSFFECKRSLLDNRRRFRGHKGY 394 ++ K+PR+CLK+G C L+ +FFECKRS+LDNR RFRG KGY Sbjct: 33 QEGKSPRQCLKEGY----CNSLKYAFFECKRSVLDNRARFRGRKGY 74 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,588,462 Number of Sequences: 237096 Number of extensions: 1605381 Number of successful extensions: 6096 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6094 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8959138240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -