BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0677 (663 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 109 6e-26 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 28 0.30 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 25 2.1 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 2.1 Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related prot... 24 4.9 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 23 6.5 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 6.5 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 8.6 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 8.6 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 8.6 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 8.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 8.6 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 109 bits (263), Expect = 6e-26 Identities = 46/75 (61%), Positives = 59/75 (78%) Frame = +3 Query: 21 EEHKDEKSVWIIIHNDVYDVTKFLEEHPGGADSLLEVAGKDGTQAFEDVGHSDDARELLK 200 + H KS WI+IHND+YDVT+FL EHPGG + LLE AG++ T+AFEDVGHS DARE++K Sbjct: 13 KSHNTNKSTWIVIHNDIYDVTEFLNEHPGGEEVLLEQAGREATEAFEDVGHSSDAREMMK 72 Query: 201 KYKIGTLPPGERCKI 245 K+K+G L ER +I Sbjct: 73 KFKVGELIEAERKQI 87 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 27.9 bits (59), Expect = 0.30 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 87 FLEEHPGGADSLLEVAGKDGTQAFEDVGHSDDARE 191 +LE++P G LE+ GK+G +E + SD E Sbjct: 61 YLEKNPLGKVPALEIPGKEGVTLYESLVLSDYIEE 95 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 25.0 bits (52), Expect = 2.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 495 LGWLGGEVAAPGLDAYHC 548 +GW VA PG +AY+C Sbjct: 290 VGWNDWIVAPPGYEAYYC 307 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.0 bits (52), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 196 NNSRASSLCPTSSKAWVPS--FPATSNNESAPP 104 ++S A SLCPTS A V + PA+S + A P Sbjct: 250 SSSAAGSLCPTSPPASVSNGEQPASSVGDPANP 282 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 201 SSTTLEHHHYVPRLQKPGFHPSLPLLTMNQLHL 103 ++ + HHH+ P PG + + Q HL Sbjct: 152 AAAAMHHHHHHPHHHHPGLTGLMQAPSQQQQHL 184 >Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related protease protein. Length = 273 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 210 FCISSTTLEHHHYVPRLQKPGFHPSLPLL 124 F + T E H +L +P FHP+ P L Sbjct: 17 FACALTQAEKRH---KLTRPAFHPNAPYL 42 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 23.4 bits (48), Expect = 6.5 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -2 Query: 620 RLPTVSAREHTRCYVHMIFSKTDNTVVRVQPGCRDL 513 R+ T S CY H + + RV CRD+ Sbjct: 336 RISTASGDGKHYCYPHFTCAVDTENIKRVFNDCRDI 371 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 366 NPIDLKSDYQDVNEYGTILER 428 N ++LKS+Y ++ E +LER Sbjct: 116 NAVNLKSNYLELTELKHVLER 136 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.0 bits (47), Expect = 8.6 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = +3 Query: 612 WQPVDIVDCAGDVRDLT 662 W P++++ GD+ LT Sbjct: 141 WNPIEVIQTNGDIPPLT 157 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.0 bits (47), Expect = 8.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 213 GTLPPGERCKIITDCSKLKW 272 G PPG + DC+KL++ Sbjct: 648 GQAPPGRLVTPVYDCAKLRY 667 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 8.6 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 Query: 235 LSPGGNVPILYFFNNSRASSLCPTSSKAWVPSFPATSNNESA 110 L P G++ + + A++L PT++ PSF TS + A Sbjct: 814 LYPNGSIGGVNSLAAAAAATLIPTATTNVRPSFTTTSISNGA 855 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 8.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +3 Query: 213 GTLPPGERCKIITDCSKLKW 272 G PPG + DC+KL++ Sbjct: 692 GQAPPGRLVTPVYDCAKLRY 711 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 8.6 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 Query: 235 LSPGGNVPILYFFNNSRASSLCPTSSKAWVPSFPATSNNESA 110 L P G++ + + A++L PT++ PSF TS + A Sbjct: 813 LYPNGSIGGVNSLAAAAAATLIPTATTNVRPSFTTTSISNGA 854 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 746,287 Number of Sequences: 2352 Number of extensions: 16354 Number of successful extensions: 39 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -