BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0674 (734 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00015B5CE8 Cluster: PREDICTED: hypothetical protein;... 38 0.26 UniRef50_UPI000155C8E1 Cluster: PREDICTED: similar to Ubiquitin ... 38 0.26 UniRef50_UPI0000E476CA Cluster: PREDICTED: similar to KIAA0445 p... 33 5.5 >UniRef50_UPI00015B5CE8 Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 308 Score = 37.9 bits (84), Expect = 0.26 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +3 Query: 264 QIKLYFINFTEKFLMCENDDCEFPFGHEDLQFV 362 +I+ + +N TE LMC +++C +P GH+ L F+ Sbjct: 16 KIRAFQLNHTEAVLMCSSEECIWPVGHQKLTFI 48 >UniRef50_UPI000155C8E1 Cluster: PREDICTED: similar to Ubiquitin specific peptidase like 1; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to Ubiquitin specific peptidase like 1 - Ornithorhynchus anatinus Length = 1102 Score = 37.9 bits (84), Expect = 0.26 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +3 Query: 267 IKLYFINFTEKFLMCENDDCEFPFGHEDLQFVKLGND 377 ++ Y INF E ++CEN C +P G++ L + + +D Sbjct: 56 LRTYQINFQESIVLCENPQCIYPLGYKPLNKILISSD 92 >UniRef50_UPI0000E476CA Cluster: PREDICTED: similar to KIAA0445 protein; n=6; Deuterostomia|Rep: PREDICTED: similar to KIAA0445 protein - Strongylocentrotus purpuratus Length = 2435 Score = 33.5 bits (73), Expect = 5.5 Identities = 16/40 (40%), Positives = 27/40 (67%) Frame = +3 Query: 459 NIAWGEIEKMNRIYESEDSQLETRLLNSSADRDHVLMKSQ 578 N A G +++ NR+ ++E S++E L +S ADRD + +K Q Sbjct: 68 NPALGNLQEENRMLQNELSRVEDLLSSSRADRDELAIKYQ 107 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,737,498 Number of Sequences: 1657284 Number of extensions: 9689439 Number of successful extensions: 18483 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18473 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59677054775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -