BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0673 (740 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. 28 0.26 AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CY... 25 1.9 >AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. Length = 140 Score = 28.3 bits (60), Expect = 0.26 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 510 NSWNTKLQSLNSDARSYVGFDWNIHNVYWFDSNLHQQFPNVP 635 +S++T N+D + G + I+N YW DS+ N+P Sbjct: 53 SSYSTTATHKNTDGSTDYGI-FQINNAYWCDSHYGSNLCNIP 93 >AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CYP4C26 protein. Length = 154 Score = 25.4 bits (53), Expect = 1.9 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -3 Query: 717 NPEPFSFDDLFVGECHGQHSH 655 NP+ F+ D+ CHG+H + Sbjct: 115 NPDKFNPDNFLPENCHGRHPY 135 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 803,233 Number of Sequences: 2352 Number of extensions: 17536 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -