BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0672 (605 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 99 5e-36 SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) 30 1.7 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 24 2.1 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 29 2.9 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 28 5.1 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 28 5.1 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 28 5.1 SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.3 SB_20312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) 25 9.8 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.7 bits (235), Expect(2) = 5e-36 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +3 Query: 60 TTMGDIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 239 T ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 585 TMAEELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 70.5 bits (165), Expect(2) = 5e-36 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +3 Query: 339 QLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKELLCTVLKSCGEECVIA 518 ++T+I +DGYL LM DNGD R D+K+ D D+ ++R F++ + + TVLK+ GEE V+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDIAKEIRAKFEASENFMVTVLKAMGEETVVG 702 Query: 519 VK 524 VK Sbjct: 703 VK 704 >SB_8527| Best HMM Match : zf-C2H2 (HMM E-Value=4.3e-21) Length = 1049 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = -2 Query: 571 NPINAELVYLSRAVF---ALTAMTHSSPQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSS 401 NP L Y + A+F + A S QD+ +H NS + N +P+ S I ++ Sbjct: 69 NPSFGPLNYATMAIFPPNTVPAPPQDSTQDYREIHTNSFYFQHQMSNTLPKEES-IQQAD 127 Query: 400 RRSPLSAIRV 371 +P + V Sbjct: 128 ESAPHDILSV 137 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 24.2 bits (50), Expect(2) = 2.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +1 Query: 124 SPCNVRPCVKMVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKSMK 282 +PC ++ C + +S+ V ++K P P TL ++G + +K +K Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVK 450 Score = 23.8 bits (49), Expect(2) = 2.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 106 PGPQPPSPCNVRP 144 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 73 TSKTHTLRPETPGPQPPSPCNVRPCVKMVSLC*RVVH-ARLLKCPH 207 T+K HT +P T P P N+ P + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 37 LTVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRPC 147 L K KT + T+K +T +P T P+ P +PC Sbjct: 96 LYTTKPKTTKPHTNKPYTTKPRTTKPRTTKPHTTKPC 132 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 150 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNG 269 + G +M +G+PCKI + K G HG +H+ G D NG Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG 55 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.7 bits (61), Expect = 3.9 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 264 NGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNG 392 NG Y CP N D + EDY + D YLT D G Sbjct: 400 NGHTYHMTCPGQTNFDPAKKRCEDYDCSG-RDVAYLTDQNDGG 441 >SB_4237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 3.9 Identities = 21/84 (25%), Positives = 37/84 (44%) Frame = +3 Query: 291 PSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLRTDFDSGKE 470 P + + V + +++ D + ADN + RE+ + +L ++ T G Sbjct: 284 PESDGIRVDETENGEHEAVDELPEDKPDTEADNYEQREETPTKEDELKSECTTSDSEGTP 343 Query: 471 LLCTVLKSCGEECVIAVKANTALD 542 T KS GEE V A ++ +LD Sbjct: 344 SAATYGKSDGEENV-AQESEESLD 366 >SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 28.7 bits (61), Expect = 3.9 Identities = 30/131 (22%), Positives = 53/131 (40%), Gaps = 8/131 (6%) Frame = +3 Query: 84 THFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKT-----GKHGHAKVHLV 248 T E+G + P QC+ + F+ RP + + S ++ G + L Sbjct: 865 TRRESGQRVSHGLSPKQCAVSVVSSFMDSGARPRRFLPGSQARPRRFLPGSQPRPRRFLP 924 Query: 249 GIDIFNGKKYE--DICPSTHNMDVPHVKREDYQLTDISD-DGYLTLMADNGDLREDLKIP 419 + + G Y ++ P +D+ + Y++ ++ D YL L D GD LK+ Sbjct: 925 VLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYPVLKLD 984 Query: 420 DGDLGTQLRTD 452 GD L+ D Sbjct: 985 PGDFYPVLKRD 995 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = -2 Query: 499 PQDFSTVHNNSLPLSKSVRNCVPRSPSGILRSSRRSPLSAIRVR 368 P+ S V + +LP+ V C+P SPS I RS P VR Sbjct: 253 PRQISNVRSLTLPVRYQVIGCLP-SPSDIKRSVPYPPRQISNVR 295 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = -3 Query: 162 RNHFYAGPNIAW--GRWLRPRSLRSQSV 85 R F+ PN+A G+WL P+SLR+ V Sbjct: 947 REGFFNNPNLAGCKGQWLGPKSLRASRV 974 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 40 TVVKFKTQQWVTSKTHTLRPETPGPQPPSPCNVRP 144 +VV + VT K T +P TP P P P RP Sbjct: 758 SVVAMPAARPVTPKPVTPKPVTPKPVTPKPVTTRP 792 >SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4538 Score = 25.0 bits (52), Expect(2) = 6.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 76 SKTHTLRPETPGPQPPSPCNVRPCV 150 SK+H ++ T GP+ SP N R + Sbjct: 4412 SKSHPMQARTQGPRTHSPYNGRKSI 4436 Score = 21.0 bits (42), Expect(2) = 6.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 196 KCPHPKPESTATLKFTWLGLISSMVKSMK 282 K P P ++ FTW ISS+ SM+ Sbjct: 4474 KNPGYGPAKELSIAFTWGFSISSLRSSMQ 4502 >SB_20312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -2 Query: 580 KFVNPINAELVY---LSRAVFALTAMTHSSPQDFSTVHNNSLPLSKSVRNC 437 KF++P +A + +R+ + T M+H SP + +T + KS R C Sbjct: 23 KFIDPTSARISNQKAANRSQQSATQMSHKSPTNCTTCRMSDFSAGKSRREC 73 >SB_6613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 27.9 bits (59), Expect = 6.7 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Frame = +3 Query: 306 MDVPHVKREDYQLTDISDDGYLT----LMADNGDLREDLKIPDGDLGTQLRTDFDSGKEL 473 +D+P+ K + + L ++DD L+ + D L E L PD + R D G E Sbjct: 37 LDIPYEKYDKFDLESLTDDECLSEFRFIKNDLYRLNEALNFPD-QITCPNRLTVD-GMEA 94 Query: 474 LCTVLKSCGEEC 509 LC L+ C Sbjct: 95 LCMTLRRFAYPC 106 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +1 Query: 61 QQWVTSKTHTLRPETPGPQPPSPCNVRPCVKMVSLC*RVVHARLLKCPHPKP 216 +Q V S P P P PP+PC + PC + +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) Length = 605 Score = 25.0 bits (52), Expect(2) = 9.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 79 KTHTLRPETPGPQPPSP 129 K H +P P P PPSP Sbjct: 344 KEHPDKPRDPAPVPPSP 360 Score = 20.6 bits (41), Expect(2) = 9.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 103 TPGPQPPSPCNVRP 144 T GP PP+ N +P Sbjct: 377 TFGPPPPAASNAKP 390 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,264,615 Number of Sequences: 59808 Number of extensions: 471443 Number of successful extensions: 1487 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1474 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -