BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0663 (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52369| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.18) 29 3.0 SB_51152| Best HMM Match : Rep-A_N (HMM E-Value=0.049) 28 5.2 >SB_52369| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.18) Length = 308 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = -3 Query: 97 LVARGFLVTALITDYIIGGCVLTH 26 +V + F+ +A+I DY GGC+++H Sbjct: 153 IVPKDFINSAVINDYQPGGCIVSH 176 >SB_51152| Best HMM Match : Rep-A_N (HMM E-Value=0.049) Length = 812 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -3 Query: 541 FIKNNYQLNTFQIFHSTDTYFEPTIIDVFNCTSIKLTPINF 419 F + ++L+TF+I +TY E T + C+ + + P+N+ Sbjct: 543 FASSEFKLHTFKIRAKMETYNEETRL---KCSVVNVVPVNY 580 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,376,143 Number of Sequences: 59808 Number of extensions: 257358 Number of successful extensions: 452 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -