BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0663 (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 1.9 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 23 5.9 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 23 5.9 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.0 bits (52), Expect = 1.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 1 GDTYDRLSRASGHSRRLYNL*LVRSPK 81 G+T+D L AS RRL L + +S K Sbjct: 802 GETFDELPTASARPRRLSELSVKKSKK 828 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 23.4 bits (48), Expect = 5.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 550 TDTFIKNNYQLNTFQIFHSTDTYFEPT 470 T FI NNY+LNT + + S F P+ Sbjct: 58 TVVFI-NNYELNTSERYWSEPKRFNPS 83 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 23.4 bits (48), Expect = 5.9 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = -3 Query: 550 TDTFIKNNYQLNTFQIFHSTDTYF----EPTIIDVFNCTSIK 437 TD + N + FQ FH TY+ +P +FN K Sbjct: 26 TDLELVKNVFVKDFQYFHDRGTYYNEKHDPLSAHLFNLEGYK 67 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,070 Number of Sequences: 2352 Number of extensions: 10092 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -