BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0663 (612 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42836-2|ABC48244.1| 278|Caenorhabditis elegans Hypothetical pr... 28 4.6 U42836-1|ABC48243.1| 497|Caenorhabditis elegans Hypothetical pr... 28 4.6 U80955-2|AAM97946.1| 181|Caenorhabditis elegans Mlp/crp family ... 28 6.0 AY204199-1|AAO39200.1| 360|Caenorhabditis elegans nuclear recep... 28 6.0 AL022288-6|CAA18368.1| 341|Caenorhabditis elegans Hypothetical ... 28 6.0 >U42836-2|ABC48244.1| 278|Caenorhabditis elegans Hypothetical protein T21F2.1b protein. Length = 278 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 445 SIKLTPINFSCYDIFFTFYYL 383 S KL P+ F+ ++IF+ FYY+ Sbjct: 251 SAKLFPLLFTAFNIFYWFYYI 271 >U42836-1|ABC48243.1| 497|Caenorhabditis elegans Hypothetical protein T21F2.1a protein. Length = 497 Score = 28.3 bits (60), Expect = 4.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 445 SIKLTPINFSCYDIFFTFYYL 383 S KL P+ F+ ++IF+ FYY+ Sbjct: 470 SAKLFPLLFTAFNIFYWFYYI 490 >U80955-2|AAM97946.1| 181|Caenorhabditis elegans Mlp/crp family (muscle lim protein/cysteine-rich protein) protein 1, isoform c protein. Length = 181 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 457 FNCTSIKLTPINFSCYDIFFTFYYLNGCTVA 365 F T + +T +N SC+ + L+ CTVA Sbjct: 89 FGNTEVDMTLVNVSCFKTYMCNKLLDSCTVA 119 >AY204199-1|AAO39200.1| 360|Caenorhabditis elegans nuclear receptor NHR-113 protein. Length = 360 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 345 IASSPLGKYFKIIT*YN*SLILFYNPNVKDKEEKTQKNLYK 223 I P+GKY KI+ Y L+ FY V+ +KN K Sbjct: 137 IIEKPIGKYSKILKRYPQELLQFYVKEVEKTIANRRKNSSK 177 >AL022288-6|CAA18368.1| 341|Caenorhabditis elegans Hypothetical protein ZK1025.9 protein. Length = 341 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 345 IASSPLGKYFKIIT*YN*SLILFYNPNVKDKEEKTQKNLYK 223 I P+GKY KI+ Y L+ FY V+ +KN K Sbjct: 118 IIEKPIGKYSKILKRYPQELLQFYVKEVEKTIANRRKNSSK 158 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,792,418 Number of Sequences: 27780 Number of extensions: 214626 Number of successful extensions: 379 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -