BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0660 (640 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.62 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 23 3.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 4.4 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 4.4 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 4.4 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.0 bits (52), Expect = 0.62 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 233 YNDPRFRTVEAGPTLGHYWKNG 298 YN RFR + G + ++W NG Sbjct: 388 YNMVRFRNLVKGTKIDNWWDNG 409 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/38 (21%), Positives = 17/38 (44%) Frame = +2 Query: 320 DYVEEVYDASQYHGQDGLGAYAYGYQTPESAKVENRVR 433 DY E +Y+G + + Y Y+ + + N ++ Sbjct: 247 DYGNEAISKREYNGIGAVIEFKYSYEISNAFRGNNNLK 284 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 401 EFGIRRHMHLDRLVRGIG 348 ++ + RH H+ RLV IG Sbjct: 104 KYWVERHKHIVRLVTAIG 121 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 322 VLSILDFLSVLPVVSKSGACF 260 V +ILD S VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 322 VLSILDFLSVLPVVSKSGACF 260 V +ILD S VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 322 VLSILDFLSVLPVVSKSGACF 260 V +ILD S VVSKSG F Sbjct: 298 VQNILDTQSSAKVVSKSGVLF 318 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,471 Number of Sequences: 438 Number of extensions: 3653 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -