BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0659 (672 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1HPL9 Cluster: Acyl carrier protein; n=2; Bombyx mori|... 299 3e-80 UniRef50_Q7QDX1 Cluster: Acyl carrier protein; n=5; cellular org... 152 9e-36 UniRef50_UPI00015B46C0 Cluster: PREDICTED: similar to GA21583-PA... 143 4e-33 UniRef50_Q94519 Cluster: Acyl carrier protein, mitochondrial pre... 141 2e-32 UniRef50_UPI0000514F0D Cluster: PREDICTED: similar to mitochondr... 131 2e-29 UniRef50_O14561 Cluster: Acyl carrier protein, mitochondrial pre... 130 3e-29 UniRef50_Q6DH81 Cluster: Acyl carrier protein; n=4; Danio rerio|... 128 9e-29 UniRef50_Q9U241 Cluster: Acyl carrier protein; n=2; Caenorhabdit... 125 1e-27 UniRef50_Q5BT32 Cluster: Acyl carrier protein; n=1; Schistosoma ... 108 1e-22 UniRef50_A7RJH5 Cluster: Predicted protein; n=1; Nematostella ve... 91 2e-17 UniRef50_UPI0000D9DF27 Cluster: PREDICTED: NADH dehydrogenase (u... 90 5e-17 UniRef50_O44630 Cluster: Acyl carrier protein; n=1; Caenorhabdit... 89 1e-16 UniRef50_P11943 Cluster: Acyl carrier protein, mitochondrial pre... 86 6e-16 UniRef50_UPI0001552A14 Cluster: PREDICTED: hypothetical protein;... 85 1e-15 UniRef50_A1BQ67 Cluster: Acyl carrier protein; n=1; Brugia malay... 83 8e-15 UniRef50_Q5ENV5 Cluster: Mitochondrial acyl carrier protein; n=1... 80 4e-14 UniRef50_Q8LEU1 Cluster: Acyl carrier protein, putative; n=6; Vi... 79 1e-13 UniRef50_Q4PGI5 Cluster: Acyl carrier protein; n=1; Ustilago may... 78 2e-13 UniRef50_A2RB66 Cluster: Acyl carrier protein; n=9; Pezizomycoti... 77 3e-13 UniRef50_Q4DKQ2 Cluster: Acyl carrier protein, mitochondrial, pu... 77 4e-13 UniRef50_Q5AA45 Cluster: Acyl carrier protein; n=6; Saccharomyce... 77 4e-13 UniRef50_P53665 Cluster: Acyl carrier protein, mitochondrial pre... 75 2e-12 UniRef50_Q10217 Cluster: Putative acyl carrier protein, mitochon... 74 3e-12 UniRef50_Q8R9W1 Cluster: Acyl carrier protein; n=29; cellular or... 73 6e-12 UniRef50_Q00SL4 Cluster: Acyl carrier protein 1; n=2; Ostreococc... 72 1e-11 UniRef50_A3AK43 Cluster: Acyl carrier protein; n=1; Oryza sativa... 71 3e-11 UniRef50_Q9FGJ4 Cluster: Acyl carrier protein-like; n=1; Arabido... 70 6e-11 UniRef50_Q6AUP3 Cluster: Acyl carrier protein; n=6; cellular org... 68 2e-10 UniRef50_O19921 Cluster: Acyl carrier protein; n=2; Rhodophyta|R... 68 2e-10 UniRef50_Q7M9W1 Cluster: Acyl carrier protein; n=4; Bacteria|Rep... 68 2e-10 UniRef50_Q8RGX5 Cluster: Acyl carrier protein; n=10; Bacteria|Re... 67 3e-10 UniRef50_O67611 Cluster: Acyl carrier protein; n=41; cellular or... 66 6e-10 UniRef50_P32463 Cluster: Acyl carrier protein, mitochondrial pre... 66 6e-10 UniRef50_Q2A9Q5 Cluster: Acyl carrier protein, putative; n=1; Br... 65 1e-09 UniRef50_Q5BRK9 Cluster: Acyl carrier protein; n=1; Schistosoma ... 65 2e-09 UniRef50_Q20122 Cluster: Acyl carrier protein; n=3; Chromadorea|... 65 2e-09 UniRef50_Q8XJN7 Cluster: Acyl carrier protein; n=7; cellular org... 65 2e-09 UniRef50_Q62LT9 Cluster: Acyl carrier protein; n=41; Bacteria|Re... 64 3e-09 UniRef50_Q3VWC7 Cluster: Acyl carrier protein; n=2; Bacteria|Rep... 64 4e-09 UniRef50_A4KRQ8 Cluster: Acyl carrier protein; n=10; Francisella... 64 4e-09 UniRef50_Q7W5I7 Cluster: Acyl carrier protein; n=29; Bacteria|Re... 64 4e-09 UniRef50_A0PXB7 Cluster: Acyl carrier protein; n=1; Clostridium ... 63 5e-09 UniRef50_A7PV39 Cluster: Chromosome chr4 scaffold_32, whole geno... 63 7e-09 UniRef50_A3LUI7 Cluster: Mitochondrial acyl carrier protein; n=5... 62 9e-09 UniRef50_P94123 Cluster: Acyl carrier protein; n=5; cellular org... 62 1e-08 UniRef50_P58553 Cluster: Acyl carrier protein; n=16; Bacteria|Re... 62 1e-08 UniRef50_Q6FPD5 Cluster: Acyl carrier protein; n=1; Candida glab... 62 2e-08 UniRef50_Q029W4 Cluster: Acyl carrier protein; n=2; Bacteria|Rep... 61 2e-08 UniRef50_A7HDZ1 Cluster: Acyl carrier protein; n=3; Bacteria|Rep... 61 2e-08 UniRef50_Q54E22 Cluster: Acyl carrier protein; n=1; Dictyosteliu... 61 2e-08 UniRef50_Q92GD8 Cluster: Acyl carrier protein; n=10; Rickettsia|... 61 2e-08 UniRef50_Q9A7P3 Cluster: Acyl carrier protein; n=4; cellular org... 61 2e-08 UniRef50_A4J685 Cluster: Acyl carrier protein; n=3; Clostridiale... 61 3e-08 UniRef50_A7PPF5 Cluster: Chromosome chr8 scaffold_23, whole geno... 61 3e-08 UniRef50_P0A6B3 Cluster: Acyl carrier protein; n=84; Bacteria|Re... 60 4e-08 UniRef50_O54439 Cluster: Acyl carrier protein 1; n=91; Bacteria|... 60 5e-08 UniRef50_Q6C7X2 Cluster: Similar to sp|P11943 Neurospora crassa ... 60 6e-08 UniRef50_Q5KI56 Cluster: Acyl carrier, putative; n=1; Filobasidi... 60 6e-08 UniRef50_Q757B0 Cluster: Acyl carrier protein; n=1; Eremothecium... 59 1e-07 UniRef50_Q057L2 Cluster: Acyl carrier protein; n=1; Buchnera aph... 58 1e-07 UniRef50_UPI00006CFAC7 Cluster: hypothetical protein TTHERM_0047... 58 2e-07 UniRef50_A5CCL8 Cluster: Acyl carrier protein; n=1; Orientia tsu... 58 2e-07 UniRef50_Q2IA63 Cluster: Chloroplast acyl carrier protein; n=5; ... 58 2e-07 UniRef50_Q4WJA9 Cluster: Acyl carrier protein, putative; n=2; Tr... 58 2e-07 UniRef50_O52658 Cluster: Acyl carrier protein 2; n=16; Proteobac... 58 2e-07 UniRef50_Q1D5J9 Cluster: Acyl carrier protein; n=1; Myxococcus x... 57 3e-07 UniRef50_Q9KQH8 Cluster: Acyl carrier protein; n=37; Bacteria|Re... 57 4e-07 UniRef50_P80923 Cluster: Acyl carrier protein; n=7; Proteobacter... 57 4e-07 UniRef50_Q7V4J6 Cluster: Acyl carrier protein; n=4; cellular org... 57 4e-07 UniRef50_P63448 Cluster: Acyl carrier protein; n=36; Bacteria|Re... 56 8e-07 UniRef50_Q4EAK0 Cluster: Acyl carrier protein; n=4; Wolbachia|Re... 55 2e-06 UniRef50_Q1ETY1 Cluster: Acyl carrier protein; n=4; Clostridiale... 55 2e-06 UniRef50_Q9Z8P3 Cluster: Acyl carrier protein; n=2; Bacteria|Rep... 55 2e-06 UniRef50_P0A4W7 Cluster: Meromycolate extension acyl carrier pro... 55 2e-06 UniRef50_Q41D39 Cluster: Acyl carrier protein; n=1; Exiguobacter... 54 2e-06 UniRef50_P57433 Cluster: Acyl carrier protein; n=5; cellular org... 54 2e-06 UniRef50_A4VD97 Cluster: Acyl carrier protein, putative; n=1; Te... 54 3e-06 UniRef50_Q9WZD0 Cluster: Acyl carrier protein; n=15; Bacteria|Re... 54 3e-06 UniRef50_Q1JJ87 Cluster: Acyl-carrier protein; n=10; Streptococc... 53 7e-06 UniRef50_A5KP06 Cluster: Putative uncharacterized protein; n=3; ... 52 1e-05 UniRef50_Q4N4D2 Cluster: Acyl carrier protein, putative; n=2; Th... 52 1e-05 UniRef50_Q9RT27 Cluster: Acyl carrier protein; n=103; Bacteria|R... 52 1e-05 UniRef50_Q6FDT7 Cluster: Acyl carrier protein; n=6; Bacteria|Rep... 52 1e-05 UniRef50_Q672Q9 Cluster: Acyl carrier protein precursor; n=5; Ma... 51 2e-05 UniRef50_Q88WK1 Cluster: Acyl carrier protein; n=14; Lactobacill... 51 3e-05 UniRef50_Q6A931 Cluster: Acyl carrier protein; n=1; Propionibact... 51 3e-05 UniRef50_Q2LQM3 Cluster: Acyl carrier protein; n=1; Syntrophus a... 51 3e-05 UniRef50_Q02B23 Cluster: Phosphopantetheine-binding; n=1; Soliba... 51 3e-05 UniRef50_O83786 Cluster: Acyl carrier protein; n=10; Bacteria|Re... 51 3e-05 UniRef50_Q8XPI1 Cluster: Acyl carrier protein 3; n=1; Ralstonia ... 50 4e-05 UniRef50_Q7XYK4 Cluster: Acyl carrier protein; n=1; Bigelowiella... 50 5e-05 UniRef50_Q6YPI8 Cluster: Acyl carrier protein; n=2; Candidatus P... 50 5e-05 UniRef50_A6LN81 Cluster: Phosphopantetheine-binding; n=1; Thermo... 50 7e-05 UniRef50_A0ZLF8 Cluster: Putative uncharacterized protein; n=1; ... 50 7e-05 UniRef50_A0BUU7 Cluster: Acyl carrier protein; n=2; Paramecium t... 50 7e-05 UniRef50_A0NL30 Cluster: Acyl-carrier protein; n=2; Oenococcus o... 49 1e-04 UniRef50_Q22XT6 Cluster: Acyl carrier protein; n=1; Tetrahymena ... 49 1e-04 UniRef50_Q5PBA8 Cluster: Acyl carrier protein; n=7; Anaplasmatac... 48 2e-04 UniRef50_Q8DWL8 Cluster: Putative acyl carrier protein; AcpP; AC... 48 2e-04 UniRef50_A6UAQ7 Cluster: Acyl carrier protein; n=3; Sinorhizobiu... 48 3e-04 UniRef50_O34163 Cluster: Acyl carrier protein (ACP) [Contains: B... 48 3e-04 UniRef50_Q9RK61 Cluster: Acyl carrier protein; n=2; Streptomyces... 48 3e-04 UniRef50_P49517 Cluster: Acyl carrier protein; n=4; cellular org... 48 3e-04 UniRef50_UPI000038CEA1 Cluster: COG0236: Acyl carrier protein; n... 47 4e-04 UniRef50_Q88WG7 Cluster: Acyl carrier protein; n=2; Lactobacillu... 47 5e-04 UniRef50_Q9F6D5 Cluster: Acyl carrier protein; n=1; Streptomyces... 47 5e-04 UniRef50_O51647 Cluster: Acyl carrier protein; n=8; Bacteria|Rep... 46 8e-04 UniRef50_Q2LXR0 Cluster: Acyl carrier protein; n=1; Syntrophus a... 46 0.001 UniRef50_A1AMG7 Cluster: Phosphopantetheine-binding protein; n=1... 46 0.001 UniRef50_Q6NG41 Cluster: Putative acyl carrier protein; n=1; Cor... 45 0.001 UniRef50_Q3M9C5 Cluster: Putative uncharacterized protein; n=1; ... 45 0.001 UniRef50_A0E222 Cluster: Chromosome undetermined scaffold_74, wh... 45 0.001 UniRef50_Q92P51 Cluster: Acyl carrier protein acpXL; n=34; Rhizo... 45 0.001 UniRef50_Q5M6J9 Cluster: Acyl carrier protein; n=3; Streptococcu... 44 0.003 UniRef50_Q48BT2 Cluster: Acyl carrier protein; n=1; Pseudomonas ... 44 0.003 UniRef50_Q1Q262 Cluster: Similar to acyl carrier protein; n=1; C... 44 0.003 UniRef50_A7P6D9 Cluster: Chromosome chr9 scaffold_7, whole genom... 44 0.003 UniRef50_O68916 Cluster: Acyl carrier protein; n=1; Streptomyces... 44 0.004 UniRef50_A4ZY17 Cluster: Putative uncharacterized protein; n=1; ... 44 0.004 UniRef50_A2U5G8 Cluster: Putative uncharacterized protein; n=1; ... 44 0.004 UniRef50_P11830 Cluster: Acyl carrier protein; n=3; Saccharopoly... 44 0.004 UniRef50_Q4JWI6 Cluster: AcpM protein; n=1; Corynebacterium jeik... 43 0.006 UniRef50_Q47CJ2 Cluster: Phosphopantetheine-binding; n=1; Dechlo... 43 0.006 UniRef50_Q6AM38 Cluster: Related to acyl carrier protein; n=3; D... 43 0.008 UniRef50_Q9FD17 Cluster: Acyl carrier protein; n=2; Streptomyces... 43 0.008 UniRef50_A0C2J6 Cluster: Acyl carrier protein; n=2; Paramecium t... 43 0.008 UniRef50_Q8FNJ5 Cluster: Putative acyl carrier protein; n=1; Cor... 42 0.010 UniRef50_Q2L5R3 Cluster: Putative acyl carrier protein; n=1; Clo... 42 0.010 UniRef50_A1G352 Cluster: Phosphopantetheine-binding; n=1; Salini... 42 0.010 UniRef50_Q5CBJ4 Cluster: Acyl carrier protein; n=10; Thermotogac... 42 0.014 UniRef50_A5ZMX6 Cluster: Putative uncharacterized protein; n=1; ... 42 0.014 UniRef50_Q5ENV3 Cluster: Chloroplast acyl carrier protein; n=1; ... 42 0.014 UniRef50_A7AWQ5 Cluster: Nucleolar GTP-binding protein 2, putati... 42 0.014 UniRef50_Q9X5S0 Cluster: MmcB; n=1; Streptomyces lavendulae|Rep:... 42 0.018 UniRef50_A5IHN6 Cluster: Acyl carrier protein; n=5; Legionella p... 42 0.018 UniRef50_A0YWZ6 Cluster: Putative uncharacterized protein; n=1; ... 42 0.018 UniRef50_Q6AET1 Cluster: Acyl carrier protein; n=1; Leifsonia xy... 41 0.024 UniRef50_Q0A9U8 Cluster: Phosphopantetheine-binding; n=1; Alkali... 41 0.024 UniRef50_A3VAJ7 Cluster: Acyl carrier protein; n=1; Rhodobactera... 41 0.024 UniRef50_P11829 Cluster: Acyl carrier protein 1, chloroplast pre... 41 0.024 UniRef50_Q2T6Q9 Cluster: AMP-binding domain protein; n=1; Burkho... 41 0.031 UniRef50_Q127J0 Cluster: AMP-dependent synthetase and ligase; n=... 41 0.031 UniRef50_A6P1J4 Cluster: Putative uncharacterized protein; n=1; ... 41 0.031 UniRef50_Q5YBE5 Cluster: Plastid acyl carrier protein; n=1; Heli... 41 0.031 UniRef50_P80921 Cluster: Acyl carrier protein; n=24; Bacteria|Re... 41 0.031 UniRef50_Q74GK4 Cluster: Acyl carrier protein; n=5; Geobacter|Re... 40 0.041 UniRef50_Q93I56 Cluster: Iturin A synthetase A; n=6; Bacillus|Re... 40 0.041 UniRef50_A1AMI2 Cluster: Acyl-carrier protein-like protein; n=1;... 40 0.041 UniRef50_Q6RKI4 Cluster: Polyketide synthase; n=2; Botryotinia f... 40 0.041 UniRef50_Q6RKE3 Cluster: Polyketide synthase; n=2; Fungi/Metazoa... 40 0.041 UniRef50_P07854 Cluster: Acyl carrier protein 1, chloroplast pre... 40 0.041 UniRef50_Q9F7T4 Cluster: Acyl carrier protein; n=13; Streptococc... 40 0.055 UniRef50_Q6ALF3 Cluster: Related to acyl carrier protein; n=2; D... 40 0.055 UniRef50_O67119 Cluster: Long-chain-fatty-acid CoA ligase; n=1; ... 40 0.055 UniRef50_A7LTN9 Cluster: Putative uncharacterized protein; n=1; ... 40 0.055 UniRef50_A0LPN4 Cluster: Phosphopantetheine-binding precursor; n... 40 0.055 UniRef50_A5BLR3 Cluster: Acyl carrier protein; n=4; core eudicot... 40 0.055 UniRef50_A4S5H6 Cluster: Acyl carrier protein; n=3; Chlorophyta|... 40 0.055 UniRef50_Q83NH7 Cluster: Acyl carrier protein; n=7; Actinobacter... 40 0.055 UniRef50_P02902 Cluster: Acyl carrier protein 1, chloroplast pre... 40 0.055 UniRef50_Q2GDV9 Cluster: Acyl carrier protein; n=1; Neorickettsi... 40 0.072 UniRef50_A6PQN8 Cluster: Acyl carrier protein-like protein; n=1;... 40 0.072 UniRef50_A4A0E1 Cluster: Serine/threonine-protein kinase; n=1; B... 40 0.072 UniRef50_A2YXU7 Cluster: Acyl carrier protein; n=1; Oryza sativa... 40 0.072 UniRef50_Q1K0P7 Cluster: Phosphopantetheine-binding; n=1; Desulf... 39 0.096 UniRef50_Q1GHB3 Cluster: Phosphopantetheine-binding; n=9; Alphap... 39 0.096 UniRef50_A4VSA8 Cluster: Acyl carrier protein; n=3; Streptococcu... 39 0.096 UniRef50_A1AP60 Cluster: Phosphopantetheine-binding; n=2; Desulf... 39 0.096 UniRef50_Q8EVZ1 Cluster: Acyl carrier protein; n=1; Mycoplasma p... 39 0.13 UniRef50_Q7MZB2 Cluster: D-alanine carrier protein DltC; n=1; Ph... 39 0.13 UniRef50_Q4A6Y8 Cluster: Putative acyl carrier protein; n=1; Myc... 39 0.13 UniRef50_Q30R71 Cluster: Phospholipid/glycerol acyltransferase; ... 39 0.13 UniRef50_A4F5C1 Cluster: AuaB protein; n=1; Stigmatella aurantia... 39 0.13 UniRef50_P15543 Cluster: Acyl carrier protein 3, chloroplast pre... 39 0.13 UniRef50_Q3AHI1 Cluster: Possible acyl carrier protein; n=4; Syn... 38 0.17 UniRef50_Q3D8G2 Cluster: Acyl carrier protein; n=8; Streptococcu... 38 0.17 UniRef50_Q21RA5 Cluster: Putative uncharacterized protein; n=1; ... 38 0.17 UniRef50_A7GPR0 Cluster: Phosphopantetheine-binding; n=1; Bacill... 38 0.17 UniRef50_A0W4S9 Cluster: Beta-ketoacyl synthase; n=2; Proteobact... 38 0.17 UniRef50_Q11Y41 Cluster: Acyl carrier protein; n=1; Cytophaga hu... 38 0.22 UniRef50_A0W3S1 Cluster: Phosphopantetheine-binding; n=1; Geobac... 38 0.22 UniRef50_Q98QK3 Cluster: Acyl carrier protein homolog; n=1; Myco... 38 0.22 UniRef50_A7DJ46 Cluster: Phosphopantetheine-binding; n=3; Methyl... 38 0.29 UniRef50_A1UBW6 Cluster: Phosphopantetheine-binding protein; n=3... 38 0.29 UniRef50_Q2TXJ8 Cluster: Polyketide synthase modules and related... 38 0.29 UniRef50_P23235 Cluster: Acyl carrier protein 2, chloroplast pre... 38 0.29 UniRef50_Q47GV2 Cluster: Phosphopantetheine-binding; n=1; Dechlo... 37 0.39 UniRef50_Q2YC16 Cluster: Phosphopantetheine-binding; n=1; Nitros... 37 0.39 UniRef50_Q1R718 Cluster: Acyl carrier protein, putative; n=7; En... 37 0.39 UniRef50_Q1N371 Cluster: Putative acyl carrier protein; n=1; Oce... 37 0.39 UniRef50_A5LD73 Cluster: Putative uncharacterized protein; n=1; ... 37 0.39 UniRef50_Q6F0M2 Cluster: Acyl carrier protein I precurser; n=3; ... 37 0.51 UniRef50_Q2YCD0 Cluster: Acyl carrier protein, ACP; n=1; Nitroso... 37 0.51 UniRef50_A6Q8W7 Cluster: Acyl carrier protein ACP; n=1; Sulfurov... 37 0.51 UniRef50_A4L2R3 Cluster: AcpP; n=6; Lactobacillus|Rep: AcpP - La... 37 0.51 UniRef50_A4FL00 Cluster: Probable acyl carrier protein; n=1; Sac... 37 0.51 UniRef50_A0BRK8 Cluster: Chromosome undetermined scaffold_123, w... 37 0.51 UniRef50_Q6KI70 Cluster: Acyl carrier protein; n=1; Mycoplasma m... 36 0.67 UniRef50_Q5QXD4 Cluster: Acyl carrier protein; n=4; Proteobacter... 36 0.67 UniRef50_Q5KZX7 Cluster: Acyl carrier protein; n=1; Geobacillus ... 36 0.67 UniRef50_Q3F0M5 Cluster: Acyl carrier protein; n=2; Bacteria|Rep... 36 0.67 UniRef50_Q08QZ9 Cluster: Coronafacic acid synthetase, acyl carri... 36 0.67 UniRef50_A4CL45 Cluster: Acyl carrier protein; n=4; Flavobacteri... 36 0.67 UniRef50_A1ASP7 Cluster: Phosphopantetheine-binding; n=1; Peloba... 36 0.67 UniRef50_A0JS86 Cluster: Phosphopantetheine-binding; n=1; Arthro... 36 0.67 UniRef50_Q7NBP1 Cluster: AcpP; n=1; Mycoplasma gallisepticum|Rep... 36 0.89 UniRef50_Q38XG3 Cluster: Acyl carrier protein; n=1; Lactobacillu... 36 0.89 UniRef50_Q2RYE6 Cluster: Acyl carrier protein; n=2; Alphaproteob... 36 0.89 UniRef50_Q6DNE0 Cluster: CurM; n=1; Lyngbya majuscula|Rep: CurM ... 36 0.89 UniRef50_Q2MGC9 Cluster: ACP; n=1; Streptomyces griseus|Rep: ACP... 36 0.89 UniRef50_A6KZ42 Cluster: Putative uncharacterized protein; n=1; ... 36 0.89 UniRef50_A5NTM2 Cluster: AMP-dependent synthetase and ligase; n=... 36 0.89 UniRef50_A5IZH4 Cluster: Acyl carrier protein homolog; n=1; Myco... 36 0.89 UniRef50_A5GEF3 Cluster: Putative uncharacterized protein; n=1; ... 36 0.89 UniRef50_A4E9I2 Cluster: Putative uncharacterized protein; n=1; ... 36 0.89 UniRef50_A3XNJ1 Cluster: Putative uncharacterized protein; n=1; ... 36 0.89 UniRef50_Q56035 Cluster: Probable acyl carrier protein iacP; n=4... 36 0.89 UniRef50_P48078 Cluster: Acyl carrier protein; n=1; Cyanophora p... 36 0.89 UniRef50_Q9PPY4 Cluster: Acyl carrier protein homolog; n=1; Urea... 36 0.89 UniRef50_Q83EJ7 Cluster: Acyl carrier protein; n=3; Coxiella bur... 36 1.2 UniRef50_Q47ZG8 Cluster: Polyunsaturated fatty acid synthase Pfa... 36 1.2 UniRef50_Q9L4X3 Cluster: NysI; n=4; root|Rep: NysI - Streptomyce... 36 1.2 UniRef50_Q1IMP1 Cluster: AMP-dependent synthetase and ligase; n=... 36 1.2 UniRef50_Q0G361 Cluster: Putative uncharacterized protein; n=3; ... 36 1.2 UniRef50_A5W7D5 Cluster: Beta-ketoacyl synthase-like protein pre... 36 1.2 UniRef50_A4X8N7 Cluster: Phosphopantetheine-binding; n=1; Salini... 36 1.2 UniRef50_A0NLC3 Cluster: D-alanyl carrier protein; n=4; Lactobac... 36 1.2 UniRef50_A0M1T4 Cluster: Acyl-carrier protein; n=5; Flavobacteri... 36 1.2 UniRef50_A6XGU0 Cluster: Acyl carrier protein, isoform 1; n=1; P... 36 1.2 UniRef50_Q8GGP0 Cluster: Acyl carrier protein type II; n=1; Stre... 35 1.6 UniRef50_Q12FH1 Cluster: Phosphopantetheine-binding; n=7; Bacter... 35 1.6 UniRef50_Q11T85 Cluster: Acyl carrier protein; n=10; Bacteria|Re... 35 1.6 UniRef50_A6PSD7 Cluster: Putative uncharacterized protein; n=1; ... 35 1.6 UniRef50_A6PQQ2 Cluster: Acyl-carrier protein-like protein; n=1;... 35 1.6 UniRef50_A5UXC0 Cluster: Beta-ketoacyl synthase; n=2; Roseiflexu... 35 1.6 UniRef50_A3U6K2 Cluster: Acyl carrier protein; n=5; Bacteria|Rep... 35 1.6 UniRef50_A0UWW3 Cluster: Putative uncharacterized protein; n=1; ... 35 1.6 UniRef50_Q6XI20 Cluster: Similar to Drosophila melanogaster mtac... 35 1.6 UniRef50_UPI000150ABE5 Cluster: ACYL CARRIER PROTEIN ACPA; n=1; ... 35 2.1 UniRef50_Q9K3H3 Cluster: Putative acyl carrier protein; n=1; Str... 35 2.1 UniRef50_Q7UV18 Cluster: Similar to acyl carrier protein; n=1; P... 35 2.1 UniRef50_Q0LNS7 Cluster: Amino acid adenylation; n=1; Herpetosip... 35 2.1 UniRef50_Q0AYW1 Cluster: Acyl carrier protein; n=1; Syntrophomon... 35 2.1 UniRef50_Q097P4 Cluster: Acyl-carrier-like protein; n=1; Stigmat... 35 2.1 UniRef50_A5TWP6 Cluster: Long-chain-fatty-acid--CoA ligase; n=3;... 35 2.1 UniRef50_A2VMX1 Cluster: Acyl carrier protein acpA; n=7; Mycobac... 35 2.1 UniRef50_A1AP68 Cluster: Phosphopantetheine-binding; n=1; Peloba... 35 2.1 UniRef50_Q8IIW4 Cluster: Putative uncharacterized protein; n=8; ... 35 2.1 UniRef50_UPI00015BC948 Cluster: UPI00015BC948 related cluster; n... 34 2.7 UniRef50_Q93H99 Cluster: Acyl carrier protein; n=1; Streptomyces... 34 2.7 UniRef50_Q76KY0 Cluster: Polyketide synthase modules 1-3; n=2; c... 34 2.7 UniRef50_Q21WI4 Cluster: AMP-dependent synthetase and ligase; n=... 34 2.7 UniRef50_A3ZQ92 Cluster: Saframycin Mx1 synthetase B; n=1; Blast... 34 2.7 UniRef50_A1I9L6 Cluster: Polyketide synthase modules and related... 34 2.7 UniRef50_Q93HC3 Cluster: Polyketide-8 synthase acyl carrier prot... 34 2.7 UniRef50_Q9ZAU0 Cluster: Daunorubicin acyl carrier protein; n=2;... 34 3.6 UniRef50_Q1YR10 Cluster: Putative uncharacterized protein; n=1; ... 34 3.6 UniRef50_A7CVN8 Cluster: Acyl carrier protein-like protein; n=6;... 34 3.6 UniRef50_A4SXF6 Cluster: Phosphopantetheine-binding precursor; n... 34 3.6 UniRef50_A1GCV0 Cluster: Phosphopantetheine-binding; n=2; Salini... 34 3.6 UniRef50_A0ZFX6 Cluster: Heterocyst glycolipid synthase; n=5; No... 34 3.6 UniRef50_A0W3S3 Cluster: Phosphopantetheine-binding; n=1; Geobac... 34 3.6 UniRef50_A0UVS5 Cluster: Phosphopantetheine-binding; n=1; Clostr... 34 3.6 UniRef50_A0Q8U1 Cluster: Acyl carrier protein; n=2; Mycobacteriu... 34 3.6 UniRef50_A0G714 Cluster: AMP-dependent synthetase and ligase; n=... 34 3.6 UniRef50_Q02054 Cluster: Actinorhodin polyketide synthase acyl c... 34 3.6 UniRef50_Q9A931 Cluster: Acyl carrier protein, putative; n=3; Ca... 33 4.8 UniRef50_Q830B0 Cluster: Acyl carrier protein, putative; n=5; La... 33 4.8 UniRef50_Q7UP48 Cluster: Probable acyl carrier protein; n=3; Pla... 33 4.8 UniRef50_Q7NJ73 Cluster: Gll1959 protein; n=1; Gloeobacter viola... 33 4.8 UniRef50_Q5ZTC9 Cluster: Acyl carrier protein; n=4; Legionella p... 33 4.8 UniRef50_Q2LQF4 Cluster: Acyl carrier protein; n=1; Syntrophus a... 33 4.8 UniRef50_Q49HJ8 Cluster: Acyl carrier protein; n=1; uncultured b... 33 4.8 UniRef50_Q28QE8 Cluster: Phosphopantetheine-binding; n=9; Rhodob... 33 4.8 UniRef50_Q0BUW0 Cluster: Acyl carrier protein; n=1; Granulibacte... 33 4.8 UniRef50_A6C138 Cluster: Putative uncharacterized protein; n=1; ... 33 4.8 UniRef50_A4RTM5 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 4.8 UniRef50_Q6DQW3 Cluster: Polyketide synthase; n=1; Cercospora ni... 33 4.8 UniRef50_Q6BUI1 Cluster: Debaryomyces hansenii chromosome C of s... 33 4.8 UniRef50_Q8XSU8 Cluster: Acyl carrier protein 2; n=9; Burkholder... 33 4.8 UniRef50_UPI000038CE9A Cluster: COG3321: Polyketide synthase mod... 33 6.3 UniRef50_Q7VUT3 Cluster: Acyl carrier protein; n=5; Burkholderia... 33 6.3 UniRef50_Q395E3 Cluster: Phosphopantetheine-binding protein; n=2... 33 6.3 UniRef50_Q2T4N2 Cluster: Thiotemplate mechanism natural product ... 33 6.3 UniRef50_Q8RL70 Cluster: Macp12; n=1; Pseudomonas fluorescens|Re... 33 6.3 UniRef50_Q3WHA1 Cluster: Phosphopantetheine-binding domain; n=2;... 33 6.3 UniRef50_A4X8L8 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_A4FIG3 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_A3DHK0 Cluster: Phosphopantetheine-binding; n=1; Clostr... 33 6.3 UniRef50_A1VQP7 Cluster: Phosphopantetheine-binding precursor; n... 33 6.3 UniRef50_A0UXC6 Cluster: Putative uncharacterized protein; n=1; ... 33 6.3 UniRef50_Q7SC49 Cluster: Putative uncharacterized protein NCU084... 33 6.3 UniRef50_A7ETT8 Cluster: Predicted protein; n=1; Sclerotinia scl... 33 6.3 UniRef50_Q9KBT3 Cluster: Acyl-carrier protein; n=1; Bacillus hal... 33 8.3 UniRef50_Q93H26 Cluster: Non-ribosomal peptide synthetase; n=1; ... 33 8.3 UniRef50_Q0A5F3 Cluster: Phosphopantetheine-binding; n=1; Alkali... 33 8.3 UniRef50_Q03ZD7 Cluster: Acyl carrier protein; n=1; Leuconostoc ... 33 8.3 UniRef50_A6GBC5 Cluster: Acyl carrier protein, putative; n=2; Pl... 33 8.3 UniRef50_A5GQD9 Cluster: Putative uncharacterized protein SynRCC... 33 8.3 UniRef50_A4WFR2 Cluster: Phosphopantetheine-binding; n=24; Prote... 33 8.3 UniRef50_A4BMX4 Cluster: Putative uncharacterized protein; n=1; ... 33 8.3 UniRef50_A1JJU9 Cluster: Minor pili exported protein precursor; ... 33 8.3 UniRef50_Q8I3A8 Cluster: Adapter-related protein, putative; n=2;... 33 8.3 >UniRef50_Q1HPL9 Cluster: Acyl carrier protein; n=2; Bombyx mori|Rep: Acyl carrier protein - Bombyx mori (Silk moth) Length = 153 Score = 299 bits (735), Expect = 3e-80 Identities = 146/146 (100%), Positives = 146/146 (100%) Frame = +3 Query: 48 MAAANIFRSAFGGLLRRSTTYRTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKH 227 MAAANIFRSAFGGLLRRSTTYRTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKH Sbjct: 1 MAAANIFRSAFGGLLRRSTTYRTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKH 60 Query: 228 GIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAME 407 GIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAME Sbjct: 61 GIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAME 120 Query: 408 DEFGFEIPDGDAERLVRPKDIVQYIA 485 DEFGFEIPDGDAERLVRPKDIVQYIA Sbjct: 121 DEFGFEIPDGDAERLVRPKDIVQYIA 146 >UniRef50_Q7QDX1 Cluster: Acyl carrier protein; n=5; cellular organisms|Rep: Acyl carrier protein - Anopheles gambiae str. PEST Length = 156 Score = 152 bits (368), Expect = 9e-36 Identities = 77/112 (68%), Positives = 89/112 (79%), Gaps = 1/112 (0%) Frame = +3 Query: 153 QKFSTIKAAVKIYKSQALQNGN-EKHGIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQ 329 +KF T A+ + S QNG + +R YS PLTL LIK RVLLVL+LYDK+NPE+ Sbjct: 40 EKFLTAPASALL--SPFEQNGRWQLEIVRNYSAKEPLTLQLIKERVLLVLKLYDKVNPEK 97 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 LT++SHF+NDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE+L RP DIVQYIA Sbjct: 98 LTLESHFINDLGLDSLDHVEVIMAMEDEFGFEIPDGDAEKLFRPADIVQYIA 149 >UniRef50_UPI00015B46C0 Cluster: PREDICTED: similar to GA21583-PA; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to GA21583-PA - Nasonia vitripennis Length = 154 Score = 143 bits (346), Expect = 4e-33 Identities = 79/150 (52%), Positives = 101/150 (67%), Gaps = 1/150 (0%) Frame = +3 Query: 39 LEEMAAANIFRSAFGGLLRRSTTYRTSVTCRLSTVALQQKF-STIKAAVKIYKSQALQNG 215 + +A +F + G L R+TT R +V ++ L Q+ I+ Q+L + Sbjct: 1 MASIAGVRVFARSAG--LLRNTTSRLAVLAPATSSQLNQRLVHAIRRTSAPILGQSLADP 58 Query: 216 NEKHGIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVI 395 K +R+YS PPLTL+ I+ RVLLVL+LYDKI+ +LTVDSHF+NDLGLDSLDHVEVI Sbjct: 59 CVKQ-VRQYSEKPPLTLNFIRDRVLLVLKLYDKIDASKLTVDSHFINDLGLDSLDHVEVI 117 Query: 396 MAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 MAMEDEFGFEIPD DAERLV P I +Y+A Sbjct: 118 MAMEDEFGFEIPDMDAERLVTPAAIARYVA 147 >UniRef50_Q94519 Cluster: Acyl carrier protein, mitochondrial precursor; n=5; Endopterygota|Rep: Acyl carrier protein, mitochondrial precursor - Drosophila melanogaster (Fruit fly) Length = 152 Score = 141 bits (341), Expect = 2e-32 Identities = 63/85 (74%), Positives = 76/85 (89%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMED 410 +RKYS PPL+L LI RVLLVL+LYDKI+P +L V+SHF+NDLGLDSLDHVEVIMAMED Sbjct: 61 VRKYSAKPPLSLKLINERVLLVLKLYDKIDPSKLNVESHFINDLGLDSLDHVEVIMAMED 120 Query: 411 EFGFEIPDGDAERLVRPKDIVQYIA 485 EFGFEIPD DAE+L++P DI++Y+A Sbjct: 121 EFGFEIPDSDAEKLLKPADIIKYVA 145 >UniRef50_UPI0000514F0D Cluster: PREDICTED: similar to mitochondrial acyl carrier protein 1 CG9160-PA, isoform A isoform 2; n=2; Apis mellifera|Rep: PREDICTED: similar to mitochondrial acyl carrier protein 1 CG9160-PA, isoform A isoform 2 - Apis mellifera Length = 151 Score = 131 bits (316), Expect = 2e-29 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 2/135 (1%) Frame = +3 Query: 87 LLRRSTTYRTSV--TCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKHGIRKYSGGPPL 260 L+R + +R + TC S + Q + + + G +R+Y PL Sbjct: 10 LIRNTGAFRNLISRTCLRSAITQFQLNERLFHCKRQSILTVIPQGTRVKQVRQYGHKAPL 69 Query: 261 TLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 +LDLI+ RVLLVL LYDK++ ++L+++SHFM DLGLDSLDHVE+IMA+EDEFGFEIPD D Sbjct: 70 SLDLIRQRVLLVLNLYDKVDVQKLSLNSHFMQDLGLDSLDHVEIIMAIEDEFGFEIPDMD 129 Query: 441 AERLVRPKDIVQYIA 485 A++L+RP DIV+Y+A Sbjct: 130 AQKLLRPADIVRYVA 144 >UniRef50_O14561 Cluster: Acyl carrier protein, mitochondrial precursor; n=30; Euteleostomi|Rep: Acyl carrier protein, mitochondrial precursor - Homo sapiens (Human) Length = 156 Score = 130 bits (314), Expect = 3e-29 Identities = 72/139 (51%), Positives = 94/139 (67%), Gaps = 1/139 (0%) Frame = +3 Query: 72 SAFGGLLR-RSTTYRTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKHGIRKYSG 248 +AF L R R ++ L + Q + T++ A+ + A G R+YS Sbjct: 15 AAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVL----AQVPGRVTQLCRQYSD 70 Query: 249 GPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEI 428 PPLTL+ I+ RVL VL+LYDKI+PE+L+V+SHFM DLGLDSLD VE+IMAMEDEFGFEI Sbjct: 71 MPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEI 130 Query: 429 PDGDAERLVRPKDIVQYIA 485 PD DAE+L+ P++IV YIA Sbjct: 131 PDIDAEKLMCPQEIVDYIA 149 >UniRef50_Q6DH81 Cluster: Acyl carrier protein; n=4; Danio rerio|Rep: Acyl carrier protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 155 Score = 128 bits (310), Expect = 9e-29 Identities = 73/147 (49%), Positives = 86/147 (58%), Gaps = 3/147 (2%) Frame = +3 Query: 54 AANIFRSAFGGLLRRSTTYRTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKHGI 233 AA I L RS + T T A T+ +KS Q I Sbjct: 2 AARILARCVRSLNHRSLYFNRVNTVATLTAAPLIHGRTLSHLTTGHKSSLAQVSGSSLQI 61 Query: 234 ---RKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAM 404 R++ PPLTL + RVL VL+LYDKINPE+L V SHFM DLGLDSLD VE+IMAM Sbjct: 62 FQWRQFCDSPPLTLKTVHERVLYVLKLYDKINPEKLQVTSHFMKDLGLDSLDQVEIIMAM 121 Query: 405 EDEFGFEIPDGDAERLVRPKDIVQYIA 485 EDEFGFEIPD DAE+L+ P+ +VQYIA Sbjct: 122 EDEFGFEIPDEDAEKLMTPEQVVQYIA 148 >UniRef50_Q9U241 Cluster: Acyl carrier protein; n=2; Caenorhabditis|Rep: Acyl carrier protein - Caenorhabditis elegans Length = 133 Score = 125 bits (301), Expect = 1e-27 Identities = 63/125 (50%), Positives = 83/125 (66%) Frame = +3 Query: 111 RTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKHGIRKYSGGPPLTLDLIKSRVL 290 R +V+ L TV+++ S ++ L IR+YS PLT ++ R++ Sbjct: 3 RVAVSAALRTVSVRA-LSNASVQQRVITPILLSAQKPSFQIRQYSAKAPLTKKTLEERIV 61 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 LVL LYDKI+ ++LT+DS F DLGLDSLDHVEV+MAME+EFGFEIPDGDA+R P+DI Sbjct: 62 LVLSLYDKIDAKKLTMDSDFSKDLGLDSLDHVEVVMAMEEEFGFEIPDGDADRFKTPRDI 121 Query: 471 VQYIA 485 QYIA Sbjct: 122 FQYIA 126 >UniRef50_Q5BT32 Cluster: Acyl carrier protein; n=1; Schistosoma japonicum|Rep: Acyl carrier protein - Schistosoma japonicum (Blood fluke) Length = 152 Score = 108 bits (259), Expect = 1e-22 Identities = 58/141 (41%), Positives = 84/141 (59%) Frame = +3 Query: 60 NIFRSAFGGLLRRSTTYRTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKHGIRK 239 N+F S GG + S R + F+ KA I S+ L HG++ Sbjct: 1 NLFSSVLGGFRQICLVSNLSTISRTFIATRKSVFTPFKAYSLIVPSRFLA-----HGVQ- 54 Query: 240 YSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFG 419 LT +I+ RV+LVL+LYDK++P++LT DS F D G+DSLDHVE++MA+E+EF Sbjct: 55 ------LTKPMIEDRVMLVLKLYDKVDPDKLTFDSKFREDFGIDSLDHVELVMAIEEEFC 108 Query: 420 FEIPDGDAERLVRPKDIVQYI 482 FEIPD D++ + P+DI+QY+ Sbjct: 109 FEIPDMDSQHFLTPRDIIQYV 129 >UniRef50_A7RJH5 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 149 Score = 91.1 bits (216), Expect = 2e-17 Identities = 40/86 (46%), Positives = 66/86 (76%) Frame = +3 Query: 225 HGIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAM 404 H +R ++ T+D ++++VL V++L+DK++ EQ+T++SHF+NDLGLDSLD VE++MA Sbjct: 58 HNVRLFATAAR-TIDDLRNQVLNVVKLFDKVDAEQVTLESHFINDLGLDSLDVVEIVMAF 116 Query: 405 EDEFGFEIPDGDAERLVRPKDIVQYI 482 EDEF EI D +AE+++ D V+++ Sbjct: 117 EDEFAVEISDEEAEKIMTVNDAVEFL 142 >UniRef50_UPI0000D9DF27 Cluster: PREDICTED: NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa isoform 1; n=1; Macaca mulatta|Rep: PREDICTED: NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa isoform 1 - Macaca mulatta Length = 115 Score = 89.8 bits (213), Expect = 5e-17 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = +3 Query: 327 QLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 QL+VDSHFM DLGLD LD VE+IMAMEDEFGFEIPD DAE+L+ P++IV YIA Sbjct: 56 QLSVDSHFMKDLGLDGLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIA 108 >UniRef50_O44630 Cluster: Acyl carrier protein; n=1; Caenorhabditis elegans|Rep: Acyl carrier protein - Caenorhabditis elegans Length = 246 Score = 88.6 bits (210), Expect = 1e-16 Identities = 43/79 (54%), Positives = 55/79 (69%), Gaps = 1/79 (1%) Frame = +3 Query: 252 PPLTLDLIKSRVL-LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEI 428 P L++ V V+ I+ +LT+DS F DLGLD LDHVEV+MA+E+EFGFEI Sbjct: 161 PEKAAKLLQKEVFRFVIVTSSAISSTKLTMDSDFSTDLGLDFLDHVEVVMAIEEEFGFEI 220 Query: 429 PDGDAERLVRPKDIVQYIA 485 PDGDA+R P+DI+QYIA Sbjct: 221 PDGDADRFKTPRDILQYIA 239 >UniRef50_P11943 Cluster: Acyl carrier protein, mitochondrial precursor; n=2; Pezizomycotina|Rep: Acyl carrier protein, mitochondrial precursor - Neurospora crassa Length = 134 Score = 86.2 bits (204), Expect = 6e-16 Identities = 43/85 (50%), Positives = 58/85 (68%), Gaps = 1/85 (1%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKIN-PEQLTVDSHFMNDLGLDSLDHVEVIMAME 407 +R YS G L D + SR+ VL +DK+N P+ +T +HF NDLGLDSLD VEV+MA+E Sbjct: 43 VRFYSAGGHLKKDEVFSRIAQVLSGFDKVNDPKNITETAHFANDLGLDSLDTVEVVMAIE 102 Query: 408 DEFGFEIPDGDAERLVRPKDIVQYI 482 +EF EIPD DA+++ V+YI Sbjct: 103 EEFSIEIPDKDADQIHSVDKAVEYI 127 >UniRef50_UPI0001552A14 Cluster: PREDICTED: hypothetical protein; n=2; Mus musculus|Rep: PREDICTED: hypothetical protein - Mus musculus Length = 157 Score = 85.4 bits (202), Expect = 1e-15 Identities = 58/141 (41%), Positives = 76/141 (53%), Gaps = 1/141 (0%) Frame = +3 Query: 66 FRSAFGGLLRRSTTYRTSVTCRLSTVALQQKFSTIKAAVKIYKSQALQNGNEKHGIRKYS 245 F F G +R S T + + ++KF + K YK H +YS Sbjct: 17 FSLLFLGEIRMSVTVWKNAQSFQNATLKERKFPSEKTNKAGYKCL----WRVTHLSCQYS 72 Query: 246 GGPPLTLDLIKSRVLLVLQLYDKINPEQLTVD-SHFMNDLGLDSLDHVEVIMAMEDEFGF 422 PPL L+ I+ V+ VL+LYDKI + + SHFM DLG D VE+IMAMEDEFGF Sbjct: 73 NTPPLMLEEIRDLVMYVLKLYDKIESSKRALSKSHFMKDLGSDQ---VEIIMAMEDEFGF 129 Query: 423 EIPDGDAERLVRPKDIVQYIA 485 EIP DAE+L+ P++ V IA Sbjct: 130 EIPAIDAEKLMCPQERVDSIA 150 >UniRef50_A1BQ67 Cluster: Acyl carrier protein; n=1; Brugia malayi|Rep: Acyl carrier protein - Brugia malayi (Filarial nematode worm) Length = 151 Score = 82.6 bits (195), Expect = 8e-15 Identities = 39/82 (47%), Positives = 60/82 (73%), Gaps = 5/82 (6%) Frame = +3 Query: 252 PP--LTLDLIKSRVLLVLQLYDKINPEQ---LTVDSHFMNDLGLDSLDHVEVIMAMEDEF 416 PP LT + ++ RV+ ++ +D+ E+ LT+DS F+ D+G DSLDHVE+IM++EDEF Sbjct: 62 PPRKLTFEEVEQRVMKAIRAWDRFPEEKKETLTLDSDFVKDMGFDSLDHVEIIMSLEDEF 121 Query: 417 GFEIPDGDAERLVRPKDIVQYI 482 GFEI + ++E+L P+DI +YI Sbjct: 122 GFEISELESEKLKTPRDIFKYI 143 >UniRef50_Q5ENV5 Cluster: Mitochondrial acyl carrier protein; n=1; Isochrysis galbana|Rep: Mitochondrial acyl carrier protein - Isochrysis galbana Length = 119 Score = 80.2 bits (189), Expect = 4e-14 Identities = 35/70 (50%), Positives = 52/70 (74%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 + RVL ++ ++K++P ++T +HF+NDLGLDSLD VEV+MA EDEF EI D DAE++ Sbjct: 43 VTDRVLGCVKSFEKVDPTKVTAKAHFLNDLGLDSLDTVEVVMAFEDEFVIEIQDADAEKI 102 Query: 453 VRPKDIVQYI 482 +D ++YI Sbjct: 103 QTCEDAIKYI 112 >UniRef50_Q8LEU1 Cluster: Acyl carrier protein, putative; n=6; Viridiplantae|Rep: Acyl carrier protein, putative - Arabidopsis thaliana (Mouse-ear cress) Length = 126 Score = 79.0 bits (186), Expect = 1e-13 Identities = 35/71 (49%), Positives = 53/71 (74%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 + RVL V++ + K++P ++T ++F NDLGLDSLD VEV+MA+E+EFGFEIPD +A+++ Sbjct: 50 VTDRVLSVVKNFQKVDPSKVTPKANFQNDLGLDSLDSVEVVMALEEEFGFEIPDNEADKI 109 Query: 453 VRPKDIVQYIA 485 V +IA Sbjct: 110 QSIDLAVDFIA 120 >UniRef50_Q4PGI5 Cluster: Acyl carrier protein; n=1; Ustilago maydis|Rep: Acyl carrier protein - Ustilago maydis (Smut fungus) Length = 131 Score = 77.8 bits (183), Expect = 2e-13 Identities = 35/85 (41%), Positives = 58/85 (68%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMED 410 +R Y+ L+ I++R++ VL+ ++K++P +++ S F DLGLDSLD VEV+MA+E+ Sbjct: 41 VRFYAASAGLSKSDIETRIVDVLKTFEKVDPSKVSAASSFTTDLGLDSLDAVEVVMAIEE 100 Query: 411 EFGFEIPDGDAERLVRPKDIVQYIA 485 EF EIPD +A+ + + + YIA Sbjct: 101 EFTIEIPDEEADNITTVQQAIDYIA 125 >UniRef50_A2RB66 Cluster: Acyl carrier protein; n=9; Pezizomycotina|Rep: Acyl carrier protein - Aspergillus niger Length = 175 Score = 77.4 bits (182), Expect = 3e-13 Identities = 38/86 (44%), Positives = 57/86 (66%), Gaps = 1/86 (1%) Frame = +3 Query: 228 GIRKYSGGPPLTLDLIKSRVLLVLQLYDKINP-EQLTVDSHFMNDLGLDSLDHVEVIMAM 404 G+R YS L D ++ R++ +L+ +DK++ ++ SHF NDLGLDSLD VEV+MA+ Sbjct: 45 GVRLYSAPAGLNKDEVEGRIVNLLKNFDKVSDASKINGASHFANDLGLDSLDTVEVVMAI 104 Query: 405 EDEFGFEIPDGDAERLVRPKDIVQYI 482 E+EF EIPD +A+ + V+YI Sbjct: 105 EEEFSIEIPDKEADSIHSVDKAVEYI 130 >UniRef50_Q4DKQ2 Cluster: Acyl carrier protein, mitochondrial, putative; n=5; Trypanosomatidae|Rep: Acyl carrier protein, mitochondrial, putative - Trypanosoma cruzi Length = 170 Score = 77.0 bits (181), Expect = 4e-13 Identities = 36/76 (47%), Positives = 56/76 (73%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 L D + +RVL V++ ++K++ ++T +SHF+NDLGL+SLD VEV+ A+E EF +IPD Sbjct: 89 LNKDDVLTRVLEVVKNFEKVDASKVTPESHFVNDLGLNSLDVVEVVFAIEQEFILDIPDH 148 Query: 438 DAERLVRPKDIVQYIA 485 DAE++ D V+YI+ Sbjct: 149 DAEKIQSIPDAVEYIS 164 >UniRef50_Q5AA45 Cluster: Acyl carrier protein; n=6; Saccharomycetales|Rep: Acyl carrier protein - Candida albicans (Yeast) Length = 144 Score = 77.0 bits (181), Expect = 4e-13 Identities = 39/86 (45%), Positives = 55/86 (63%), Gaps = 2/86 (2%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKINPE--QLTVDSHFMNDLGLDSLDHVEVIMAM 404 IR YS P LT D+ K R++ +L+ YDK++ ++T + F +DLGLDSLD VEVIM + Sbjct: 52 IRCYSAFPELTRDIAKERIIELLEGYDKVDQSKGEITEQNSFTSDLGLDSLDVVEVIMEL 111 Query: 405 EDEFGFEIPDGDAERLVRPKDIVQYI 482 E EF +IPD +A+ L + YI Sbjct: 112 EHEFNIQIPDNEADSLKTVGQTIDYI 137 >UniRef50_P53665 Cluster: Acyl carrier protein, mitochondrial precursor; n=7; Eukaryota|Rep: Acyl carrier protein, mitochondrial precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 122 Score = 74.9 bits (176), Expect = 2e-12 Identities = 35/85 (41%), Positives = 58/85 (68%), Gaps = 1/85 (1%) Frame = +3 Query: 231 IRKYSGGPP-LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAME 407 IR +S L+ + + RVL V++ + K++P ++T + HF NDLGLDSLD VE++MA+E Sbjct: 31 IRSFSSHDDHLSREAVVDRVLDVVKSFPKVDPSKVTPEVHFQNDLGLDSLDTVEIVMAIE 90 Query: 408 DEFGFEIPDGDAERLVRPKDIVQYI 482 +EF EIPD +A+++ ++Y+ Sbjct: 91 EEFKLEIPDKEADKIDSCSLAIEYV 115 >UniRef50_Q10217 Cluster: Putative acyl carrier protein, mitochondrial precursor; n=2; Ascomycota|Rep: Putative acyl carrier protein, mitochondrial precursor - Schizosaccharomyces pombe (Fission yeast) Length = 112 Score = 74.1 bits (174), Expect = 3e-12 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 1/70 (1%) Frame = +3 Query: 276 KSRVLLVLQLYDKI-NPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 + R+L V+ +DKI +P+++T S F NDLGLDSLD VEV+MA+E+EF +IPD DA+ + Sbjct: 36 EKRILKVVSSFDKIQDPKKVTPTSTFANDLGLDSLDAVEVVMAIEEEFSIQIPDKDADEI 95 Query: 453 VRPKDIVQYI 482 D + YI Sbjct: 96 TSVGDAISYI 105 >UniRef50_Q8R9W1 Cluster: Acyl carrier protein; n=29; cellular organisms|Rep: Acyl carrier protein - Thermoanaerobacter tengcongensis Length = 76 Score = 72.9 bits (171), Expect = 6e-12 Identities = 31/57 (54%), Positives = 47/57 (82%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 I+PE++T++S F++DLG DSLD VE+IMA+E+EF EIPD DAE++ D+V+Y++ Sbjct: 16 IDPEEITMESSFIDDLGADSLDIVELIMALEEEFDIEIPDEDAEKIKTVGDVVEYLS 72 >UniRef50_Q00SL4 Cluster: Acyl carrier protein 1; n=2; Ostreococcus|Rep: Acyl carrier protein 1 - Ostreococcus tauri Length = 116 Score = 71.7 bits (168), Expect = 1e-11 Identities = 36/85 (42%), Positives = 56/85 (65%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMED 410 +R Y G L D + RV+ V++ + K++ +++ S F +DLGLDSLD VEV+MAME+ Sbjct: 27 LRAYGAGF-LNKDDVTDRVVRVVKNFAKVDAAKVSATSAFASDLGLDSLDVVEVVMAMEE 85 Query: 411 EFGFEIPDGDAERLVRPKDIVQYIA 485 EF EIPD +A+++ + V Y+A Sbjct: 86 EFAVEIPDAEADKIQSVPEAVAYLA 110 >UniRef50_A3AK43 Cluster: Acyl carrier protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Acyl carrier protein - Oryza sativa subsp. japonica (Rice) Length = 148 Score = 70.5 bits (165), Expect = 3e-11 Identities = 33/81 (40%), Positives = 53/81 (65%), Gaps = 2/81 (2%) Frame = +3 Query: 246 GGPPLTLD--LIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFG 419 GGPP +++RV+ +++ +D+I+ +++T + F DL LDSLD VE++MA E EF Sbjct: 54 GGPPRDFSEGAVRARVVELVKKFDRIDADKVTETADFQRDLSLDSLDRVELVMAFEQEFS 113 Query: 420 FEIPDGDAERLVRPKDIVQYI 482 EIPD A++L D+ +YI Sbjct: 114 VEIPDDKADKLSCCADVAKYI 134 >UniRef50_Q9FGJ4 Cluster: Acyl carrier protein-like; n=1; Arabidopsis thaliana|Rep: Acyl carrier protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 131 Score = 69.7 bits (163), Expect = 6e-11 Identities = 33/72 (45%), Positives = 47/72 (65%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 D I SRV+ +++ YDK N ++T + F DL LDSLD E++MA+E+EF EIPD A+ Sbjct: 49 DQILSRVIELVKKYDKTNTSEVTERADFQKDLSLDSLDKTELVMAIEEEFSIEIPDEKAD 108 Query: 447 RLVRPKDIVQYI 482 +L D+ YI Sbjct: 109 KLTCCGDVATYI 120 >UniRef50_Q6AUP3 Cluster: Acyl carrier protein; n=6; cellular organisms|Rep: Acyl carrier protein - Oryza sativa subsp. japonica (Rice) Length = 558 Score = 68.1 bits (159), Expect = 2e-10 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 +T ++HF DLGLDSLD VE++MA E+EFGFEIPD +AE++ K V ++A Sbjct: 501 VTPNAHFQKDLGLDSLDTVEIVMAFEEEFGFEIPDNEAEKIDSIKTAVDFVA 552 >UniRef50_O19921 Cluster: Acyl carrier protein; n=2; Rhodophyta|Rep: Acyl carrier protein - Cyanidium caldarium Length = 86 Score = 68.1 bits (159), Expect = 2e-10 Identities = 33/75 (44%), Positives = 51/75 (68%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 +T + I +V ++ I+ EQ+ VDSHF NDLG DSLD+VE++MA+E+EF I D Sbjct: 2 VTKEEILKKVQSIVSEQLGISKEQVLVDSHFTNDLGADSLDNVELVMAIEEEFNIVISDI 61 Query: 438 DAERLVRPKDIVQYI 482 DAE++ ++ V++I Sbjct: 62 DAEKISNVREAVEFI 76 >UniRef50_Q7M9W1 Cluster: Acyl carrier protein; n=4; Bacteria|Rep: Acyl carrier protein - Wolinella succinogenes Length = 76 Score = 67.7 bits (158), Expect = 2e-10 Identities = 28/56 (50%), Positives = 43/56 (76%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +NPE++ +S F+ DLG DSLD VE++MA+E++F EIPD +AE++ D+V+YI Sbjct: 17 VNPEEVKEESKFVEDLGADSLDVVELVMALEEKFNIEIPDEEAEKIATVGDVVRYI 72 >UniRef50_Q8RGX5 Cluster: Acyl carrier protein; n=10; Bacteria|Rep: Acyl carrier protein - Fusobacterium nucleatum subsp. nucleatum Length = 75 Score = 67.3 bits (157), Expect = 3e-10 Identities = 32/71 (45%), Positives = 52/71 (73%) Frame = +3 Query: 270 LIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 L K + ++V QL ++ +Q+ +S+F++DLG DSLD VE+IM+ E+EFG EIPD +AE+ Sbjct: 2 LDKVKEIIVEQL--GVDADQIKPESNFVDDLGADSLDTVELIMSFEEEFGVEIPDTEAEK 59 Query: 450 LVRPKDIVQYI 482 + +D++ YI Sbjct: 60 IKTVQDVINYI 70 >UniRef50_O67611 Cluster: Acyl carrier protein; n=41; cellular organisms|Rep: Acyl carrier protein - Aquifex aeolicus Length = 78 Score = 66.5 bits (155), Expect = 6e-10 Identities = 30/70 (42%), Positives = 47/70 (67%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 ++ RV ++ + E++T ++ F+ DLG DSLD VE+IMA E+EFG EIPD DAE++ Sbjct: 3 LEERVKEIIAEQLGVEKEKITPEAKFVEDLGADSLDVVELIMAFEEEFGIEIPDEDAEKI 62 Query: 453 VRPKDIVQYI 482 D++ Y+ Sbjct: 63 QTVGDVINYL 72 >UniRef50_P32463 Cluster: Acyl carrier protein, mitochondrial precursor; n=5; Saccharomycetales|Rep: Acyl carrier protein, mitochondrial precursor - Saccharomyces cerevisiae (Baker's yeast) Length = 125 Score = 66.5 bits (155), Expect = 6e-10 Identities = 35/80 (43%), Positives = 53/80 (66%), Gaps = 4/80 (5%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINP----EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFE 425 L+ D + RV+ V++ +DK +P +Q++ D+ F DLGLDSLD VE+++A+E+EF E Sbjct: 40 LSKDQVSQRVIDVIKAFDKNSPNIANKQISSDTQFHKDLGLDSLDTVELLVAIEEEFDIE 99 Query: 426 IPDGDAERLVRPKDIVQYIA 485 IPD A+ L + V YIA Sbjct: 100 IPDKVADELRSVGETVDYIA 119 >UniRef50_Q2A9Q5 Cluster: Acyl carrier protein, putative; n=1; Brassica oleracea|Rep: Acyl carrier protein, putative - Brassica oleracea (Wild cabbage) Length = 92 Score = 65.3 bits (152), Expect = 1e-09 Identities = 30/72 (41%), Positives = 47/72 (65%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 D + S+V+ +++ YD + ++T + F DL LDSLD VE++MA+E+EF EIPD A+ Sbjct: 10 DQVLSKVIELVKKYDTTSASKVTETADFKKDLSLDSLDRVEIVMAIEEEFSVEIPDEKAD 69 Query: 447 RLVRPKDIVQYI 482 +L DI +I Sbjct: 70 KLTCCADIASFI 81 >UniRef50_Q5BRK9 Cluster: Acyl carrier protein; n=1; Schistosoma japonicum|Rep: Acyl carrier protein - Schistosoma japonicum (Blood fluke) Length = 110 Score = 64.9 bits (151), Expect = 2e-09 Identities = 28/48 (58%), Positives = 39/48 (81%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEF 416 ++++VL V YDKI ++LT+DS F+ DLGLDSLDH+EVIM +E+EF Sbjct: 59 VENKVLSVCSAYDKIQADKLTLDSSFIKDLGLDSLDHIEVIMEIENEF 106 >UniRef50_Q20122 Cluster: Acyl carrier protein; n=3; Chromadorea|Rep: Acyl carrier protein - Caenorhabditis elegans Length = 145 Score = 64.9 bits (151), Expect = 2e-09 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 5/82 (6%) Frame = +3 Query: 252 PP--LTLDLIKSRVLLVLQLYDKINPEQ---LTVDSHFMNDLGLDSLDHVEVIMAMEDEF 416 PP LT ++ RVL ++ +D+ ++ L +D+ D G DSLD VE++MA+EDEF Sbjct: 56 PPKQLTFKQVEDRVLKAVRSWDRFPADKESLLKLDADLSKDFGFDSLDQVEIVMALEDEF 115 Query: 417 GFEIPDGDAERLVRPKDIVQYI 482 GFEIP D+++ +D +YI Sbjct: 116 GFEIPLQDSDKFKTIRDAFKYI 137 >UniRef50_Q8XJN7 Cluster: Acyl carrier protein; n=7; cellular organisms|Rep: Acyl carrier protein - Clostridium perfringens Length = 76 Score = 64.9 bits (151), Expect = 2e-09 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +N +++T++S F++DLG DSLD VE+IMA+E+E EIPD DAE D+V+YI Sbjct: 15 VNEDEITMESTFIDDLGADSLDIVELIMALEEELEMEIPDEDAEGFKTVGDVVEYI 70 >UniRef50_Q62LT9 Cluster: Acyl carrier protein; n=41; Bacteria|Rep: Acyl carrier protein - Burkholderia mallei (Pseudomonas mallei) Length = 79 Score = 64.1 bits (149), Expect = 3e-09 Identities = 29/72 (40%), Positives = 47/72 (65%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 +D I+ RV ++ + ++ ++ F+NDLG DSLD VE++MA+EDEFG EIPD +A Sbjct: 1 MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA 60 Query: 444 ERLVRPKDIVQY 479 E++ + + Y Sbjct: 61 EKITTVQQAIDY 72 >UniRef50_Q3VWC7 Cluster: Acyl carrier protein; n=2; Bacteria|Rep: Acyl carrier protein - Prosthecochloris aestuarii DSM 271 Length = 80 Score = 63.7 bits (148), Expect = 4e-09 Identities = 29/75 (38%), Positives = 48/75 (64%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 + ++ IK +V ++ +N +Q+ +S F +DLG DSLD VE+IM +E+EF +IPD Sbjct: 1 MNVEEIKDKVFDIIVSKMGVNKDQIKTESKFADDLGADSLDTVELIMELENEFDVQIPDE 60 Query: 438 DAERLVRPKDIVQYI 482 DAE++ + + YI Sbjct: 61 DAEKISNVQQAIDYI 75 >UniRef50_A4KRQ8 Cluster: Acyl carrier protein; n=10; Francisella tularensis|Rep: Acyl carrier protein - Francisella tularensis subsp. holarctica 257 Length = 112 Score = 63.7 bits (148), Expect = 4e-09 Identities = 32/70 (45%), Positives = 46/70 (65%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I SRV ++ + E L ++ F++DLG DSLD VE++MA+E+EF EIPD DAE++ Sbjct: 37 IFSRVNHIIVEQLGVKEEDLKPEASFIDDLGADSLDTVELVMALEEEFDTEIPDEDAEKI 96 Query: 453 VRPKDIVQYI 482 KD+ YI Sbjct: 97 RTVKDVYDYI 106 >UniRef50_Q7W5I7 Cluster: Acyl carrier protein; n=29; Bacteria|Rep: Acyl carrier protein - Bordetella parapertussis Length = 79 Score = 63.7 bits (148), Expect = 4e-09 Identities = 30/73 (41%), Positives = 48/73 (65%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 ++ I+ RV ++ +N ++ +S F++DLG DSLD VE++MA+EDEF EIPD +A Sbjct: 1 MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA 60 Query: 444 ERLVRPKDIVQYI 482 E++ + V YI Sbjct: 61 EKITTVQQAVDYI 73 >UniRef50_A0PXB7 Cluster: Acyl carrier protein; n=1; Clostridium novyi NT|Rep: Acyl carrier protein - Clostridium novyi (strain NT) Length = 76 Score = 63.3 bits (147), Expect = 5e-09 Identities = 28/68 (41%), Positives = 48/68 (70%) Frame = +3 Query: 279 SRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVR 458 +RV ++ + +IN +++ + S+F +DLG+DSLD E++M +EDEF EIP+ D E + Sbjct: 4 NRVKKIMADHLEINEDEIKLGSNFQDDLGVDSLDIFEIVMEIEDEFDLEIPNEDIENVKT 63 Query: 459 PKDIVQYI 482 +D+V+YI Sbjct: 64 VEDLVKYI 71 >UniRef50_A7PV39 Cluster: Chromosome chr4 scaffold_32, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr4 scaffold_32, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 143 Score = 62.9 bits (146), Expect = 7e-09 Identities = 28/54 (51%), Positives = 40/54 (74%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 E +T ++F DLGLDSLD VEV+MA+E+EFGFEIPD +A+++ V +I+ Sbjct: 84 ESVTPTANFQTDLGLDSLDAVEVVMALEEEFGFEIPDNEADKINTINVAVDFIS 137 >UniRef50_A3LUI7 Cluster: Mitochondrial acyl carrier protein; n=5; Saccharomycetales|Rep: Mitochondrial acyl carrier protein - Pichia stipitis (Yeast) Length = 116 Score = 62.5 bits (145), Expect = 9e-09 Identities = 29/76 (38%), Positives = 47/76 (61%) Frame = +3 Query: 255 PLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 P+T + + SR L+ + +LT++++F DLGLDSLD VE ++A+E+EF EIPD Sbjct: 34 PITKEEVTSRAFEALKTVAALQESKLTLEANFQKDLGLDSLDTVEALVALEEEFDLEIPD 93 Query: 435 GDAERLVRPKDIVQYI 482 ++ + + V YI Sbjct: 94 KISDEIKTVGEAVDYI 109 >UniRef50_P94123 Cluster: Acyl carrier protein; n=5; cellular organisms|Rep: Acyl carrier protein - Azospirillum brasilense Length = 79 Score = 62.1 bits (144), Expect = 1e-08 Identities = 28/70 (40%), Positives = 47/70 (67%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 + RV ++ + + ++T ++ F++DLG DSLD VE++MA E+EFG EIPD AE++ Sbjct: 4 VAERVKKIVVDHLGVEESKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAAEKI 63 Query: 453 VRPKDIVQYI 482 + KD + +I Sbjct: 64 LTVKDAIDFI 73 >UniRef50_P58553 Cluster: Acyl carrier protein; n=16; Bacteria|Rep: Acyl carrier protein - Anabaena sp. (strain PCC 7120) Length = 84 Score = 62.1 bits (144), Expect = 1e-08 Identities = 28/64 (43%), Positives = 43/64 (67%) Frame = +3 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 +V++ NP+ +T ++ F NDL DSLD VE++MA+E+EF EIPD AE++ ++ Sbjct: 13 IVIEQLSVENPDTVTPEASFANDLQADSLDTVELVMALEEEFDIEIPDEAAEKITTVQEA 72 Query: 471 VQYI 482 V YI Sbjct: 73 VDYI 76 >UniRef50_Q6FPD5 Cluster: Acyl carrier protein; n=1; Candida glabrata|Rep: Acyl carrier protein - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 117 Score = 61.7 bits (143), Expect = 2e-08 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 1/74 (1%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQ-LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 D I +++ V++ + K Q +T DS F DLGLDSLD VE+I+++E+EF EIPD A Sbjct: 40 DEISQKLIEVVKNFVKGESSQNVTADSKFHKDLGLDSLDTVELIVSIEEEFDTEIPDDVA 99 Query: 444 ERLVRPKDIVQYIA 485 +RL ++ + Y+A Sbjct: 100 DRLTSIRETIDYLA 113 >UniRef50_Q029W4 Cluster: Acyl carrier protein; n=2; Bacteria|Rep: Acyl carrier protein - Solibacter usitatus (strain Ellin6076) Length = 109 Score = 61.3 bits (142), Expect = 2e-08 Identities = 31/69 (44%), Positives = 46/69 (66%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLV 455 K + ++V QL ++ Q+ ++ F++DLG DSLD VE++MA E+ F EIPD DAE++ Sbjct: 36 KVKQIIVEQL--GVDESQVDSNASFVDDLGADSLDIVELVMAFEEAFELEIPDEDAEKIT 93 Query: 456 RPKDIVQYI 482 KD V YI Sbjct: 94 TVKDAVDYI 102 >UniRef50_A7HDZ1 Cluster: Acyl carrier protein; n=3; Bacteria|Rep: Acyl carrier protein - Anaeromyxobacter sp. Fw109-5 Length = 80 Score = 61.3 bits (142), Expect = 2e-08 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 + +++ + S F+ DLG DSLD VE++MAME+EF EIPD +AE + +D V YI Sbjct: 20 VGEDEIKITSSFIEDLGADSLDIVELVMAMEEEFEVEIPDEEAENIKTVQDAVNYI 75 >UniRef50_Q54E22 Cluster: Acyl carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Acyl carrier protein - Dictyostelium discoideum AX4 Length = 120 Score = 61.3 bits (142), Expect = 2e-08 Identities = 27/70 (38%), Positives = 48/70 (68%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I RV+ V+ YDK++ + +T + F +LGLDSLD ++++A+E+EFG EIPD +A+++ Sbjct: 45 ITDRVIGVVSQYDKVSGKTVTPTTTF-KELGLDSLDSADILVAVEEEFGIEIPDEEADKI 103 Query: 453 VRPKDIVQYI 482 + + Y+ Sbjct: 104 TSCAETISYL 113 >UniRef50_Q92GD8 Cluster: Acyl carrier protein; n=10; Rickettsia|Rep: Acyl carrier protein - Rickettsia conorii Length = 86 Score = 61.3 bits (142), Expect = 2e-08 Identities = 30/76 (39%), Positives = 52/76 (68%), Gaps = 2/76 (2%) Frame = +3 Query: 261 TLDLIKSRVLLVLQLYDKINPEQ--LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 T D I+ +V+ ++ +K+N ++ +T DS F+ DL DSLD VE++MA+E E+G +IPD Sbjct: 8 TTDKIEQKVIEMVA--EKLNKDKSIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPD 65 Query: 435 GDAERLVRPKDIVQYI 482 +A ++ D+++YI Sbjct: 66 DEATKIKTVSDVIKYI 81 >UniRef50_Q9A7P3 Cluster: Acyl carrier protein; n=4; cellular organisms|Rep: Acyl carrier protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 78 Score = 61.3 bits (142), Expect = 2e-08 Identities = 30/72 (41%), Positives = 49/72 (68%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 D+++ +V++ D +PE++T + F++DLG DSLD+VE++MA E+EF EIPD AE Sbjct: 3 DILERVRKIVIEHLDA-DPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAAE 61 Query: 447 RLVRPKDIVQYI 482 + D V++I Sbjct: 62 HIQTVGDAVKFI 73 >UniRef50_A4J685 Cluster: Acyl carrier protein; n=3; Clostridiales|Rep: Acyl carrier protein - Desulfotomaculum reducens MI-1 Length = 74 Score = 60.9 bits (141), Expect = 3e-08 Identities = 29/69 (42%), Positives = 49/69 (71%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLV 455 K + ++V QL + ++ +++ F++DLG DSLD VE++MA+E+EFG EIPD +AE++ Sbjct: 4 KVKAIIVDQL--GVEEAEVKMEASFVDDLGADSLDIVELVMALEEEFGLEIPDEEAEKIR 61 Query: 456 RPKDIVQYI 482 D V++I Sbjct: 62 TVGDAVKFI 70 >UniRef50_A7PPF5 Cluster: Chromosome chr8 scaffold_23, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr8 scaffold_23, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 139 Score = 60.9 bits (141), Expect = 3e-08 Identities = 27/71 (38%), Positives = 48/71 (67%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 + SR++ +L+ I+P +++ + F NDL LD LD+VEV+MA+E+EF +IPD +A ++ Sbjct: 63 VTSRIIHLLKSTPFIDPSKVSPTASFKNDLQLDMLDNVEVMMAVEEEFAVDIPDTEANKI 122 Query: 453 VRPKDIVQYIA 485 ++ YI+ Sbjct: 123 STAAHLIDYIS 133 >UniRef50_P0A6B3 Cluster: Acyl carrier protein; n=84; Bacteria|Rep: Acyl carrier protein - Shigella flexneri Length = 78 Score = 60.5 bits (140), Expect = 4e-08 Identities = 28/73 (38%), Positives = 47/73 (64%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 + I+ RV ++ + E++T ++ F+ DLG DSLD VE++MA+E+EF EIPD +A Sbjct: 1 MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA 60 Query: 444 ERLVRPKDIVQYI 482 E++ + + YI Sbjct: 61 EKITTVQAAIDYI 73 >UniRef50_O54439 Cluster: Acyl carrier protein 1; n=91; Bacteria|Rep: Acyl carrier protein 1 - Pseudomonas aeruginosa Length = 78 Score = 60.1 bits (139), Expect = 5e-08 Identities = 28/73 (38%), Positives = 46/73 (63%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 + I+ RV ++ + E++T + F+ DLG DSLD VE++MA+E+EF EIPD A Sbjct: 1 MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA 60 Query: 444 ERLVRPKDIVQYI 482 E++ ++ + YI Sbjct: 61 EKITTVQEAIDYI 73 >UniRef50_Q6C7X2 Cluster: Similar to sp|P11943 Neurospora crassa Acyl carrier protein; n=1; Yarrowia lipolytica|Rep: Similar to sp|P11943 Neurospora crassa Acyl carrier protein - Yarrowia lipolytica (Candida lipolytica) Length = 106 Score = 59.7 bits (138), Expect = 6e-08 Identities = 28/61 (45%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKINP-EQLTVDSHFMNDLGLDSLDHVEVIMAME 407 IR YS LT D+I+ R++ +L+ +DK+N + +T ++ +DLGLDSLD VEV+MA+E Sbjct: 41 IRHYSSAHVLTKDMIQERIVALLESFDKVNDAKNITATANLTSDLGLDSLDVVEVVMAIE 100 Query: 408 D 410 + Sbjct: 101 E 101 >UniRef50_Q5KI56 Cluster: Acyl carrier, putative; n=1; Filobasidiella neoformans|Rep: Acyl carrier, putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 139 Score = 59.7 bits (138), Expect = 6e-08 Identities = 30/88 (34%), Positives = 53/88 (60%), Gaps = 4/88 (4%) Frame = +3 Query: 189 YKSQALQNGNEKHGIRKYSGGPP----LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMN 356 Y+ + ++ ++ +R+++ GPP LT D I +L VL + +I+ +L ++ F Sbjct: 24 YRPKPVKLLHKTFSMRRFADGPPEPLALTKDEITDMLLRVLNQFKQIDSSKLIGNASFTT 83 Query: 357 DLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 DLG DSLDH E+IM++E+ F ++ D D Sbjct: 84 DLGFDSLDHSELIMSVEETFDIDVADND 111 >UniRef50_Q757B0 Cluster: Acyl carrier protein; n=1; Eremothecium gossypii|Rep: Acyl carrier protein - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 123 Score = 58.8 bits (136), Expect = 1e-07 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 1/86 (1%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKI-NPEQLTVDSHFMNDLGLDSLDHVEVIMAME 407 +R YS L D I R++ V++ +D+ ++T S F DLGLDSLD VE+++++E Sbjct: 33 LRFYSAAQ-LNRDEITKRIINVVKAFDRTPTSAEVTEKSVFSKDLGLDSLDVVELLVSVE 91 Query: 408 DEFGFEIPDGDAERLVRPKDIVQYIA 485 +EF +IPD A+ + + V Y+A Sbjct: 92 EEFDIDIPDKVADEIKSVSEAVDYVA 117 >UniRef50_Q057L2 Cluster: Acyl carrier protein; n=1; Buchnera aphidicola str. Cc (Cinara cedri)|Rep: Acyl carrier protein - Buchnera aphidicola subsp. Cinara cedri Length = 80 Score = 58.4 bits (135), Expect = 1e-07 Identities = 27/70 (38%), Positives = 49/70 (70%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I RV ++ +IN ++++++++ NDL +DSLD VE+IM +E+EF ++ D +AE++ Sbjct: 4 INYRVKKIIAKQFQINIKKISLNNNLKNDLKIDSLDFVELIMLLEEEFNIKLFDIEAEKI 63 Query: 453 VRPKDIVQYI 482 + KDI+ YI Sbjct: 64 KKIKDIIPYI 73 >UniRef50_UPI00006CFAC7 Cluster: hypothetical protein TTHERM_00470710; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00470710 - Tetrahymena thermophila SB210 Length = 133 Score = 58.0 bits (134), Expect = 2e-07 Identities = 38/116 (32%), Positives = 68/116 (58%), Gaps = 2/116 (1%) Frame = +3 Query: 144 ALQQKFSTIK-AAVKIYKSQALQNGNEKHGIRKYSGGPPLTLDLIKSRVLLVLQLYDKI- 317 ++ K +T++ A+V Y Q + NEK G Y P D + R++ ++ L+DK+ Sbjct: 20 SILNKTNTLQWASVYNYAPQKVVLRNEKSG---YYANP----DDVARRLIRLISLHDKVQ 72 Query: 318 NPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 NP +T+ S + +++G+D L +VE+++ E+EF E+ D D ER +D V++IA Sbjct: 73 NPSAITLKSTW-SEIGVDPLSYVEIMLEAENEFYIELADEDLERFRTVEDAVEFIA 127 >UniRef50_A5CCL8 Cluster: Acyl carrier protein; n=1; Orientia tsutsugamushi Boryong|Rep: Acyl carrier protein - Orientia tsutsugamushi (strain Boryong) (Rickettsia tsutsugamushi) Length = 128 Score = 58.0 bits (134), Expect = 2e-07 Identities = 27/70 (38%), Positives = 45/70 (64%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I++ ++ ++ KI + + + ++DLGLDSLD EV++A+ED+F IPD +L Sbjct: 50 IQNEIIDIIANIAKIKDKSIISNDTALSDLGLDSLDQTEVMLAIEDKFRHSIPDEVTSKL 109 Query: 453 VRPKDIVQYI 482 + KDIV+YI Sbjct: 110 ITIKDIVEYI 119 >UniRef50_Q2IA63 Cluster: Chloroplast acyl carrier protein; n=5; cellular organisms|Rep: Chloroplast acyl carrier protein - Karlodinium micrum (Dinoflagellate) Length = 135 Score = 58.0 bits (134), Expect = 2e-07 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++ E++T + F DLG DSLD VE+IMA+E+ F EIPD +AE++ P D V I Sbjct: 76 VDAEKVTPTASFTEDLGADSLDAVELIMAIEEAFDIEIPDEEAEKMTTPGDCVTAI 131 >UniRef50_Q4WJA9 Cluster: Acyl carrier protein, putative; n=2; Trichocomaceae|Rep: Acyl carrier protein, putative - Aspergillus fumigatus (Sartorya fumigata) Length = 209 Score = 58.0 bits (134), Expect = 2e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +3 Query: 342 SHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 SHF NDLGLDSLD VEV+MA+E+EF EIPD +A+ + Sbjct: 123 SHFSNDLGLDSLDTVEVVMAIEEEFSIEIPDKEADAI 159 >UniRef50_O52658 Cluster: Acyl carrier protein 2; n=16; Proteobacteria|Rep: Acyl carrier protein 2 - Pseudomonas aeruginosa Length = 79 Score = 58.0 bits (134), Expect = 2e-07 Identities = 28/73 (38%), Positives = 45/73 (61%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 +D I++RV ++ + + +DS F ND G +SL+ VE++MA+E EFG EI D DA Sbjct: 1 MDDIETRVRKLVAARFGVEECDIRLDSDFRNDFGAESLEVVELVMALEAEFGVEIADDDA 60 Query: 444 ERLVRPKDIVQYI 482 ER+ + + Y+ Sbjct: 61 ERIETVRQAIDYL 73 >UniRef50_Q1D5J9 Cluster: Acyl carrier protein; n=1; Myxococcus xanthus DK 1622|Rep: Acyl carrier protein - Myxococcus xanthus (strain DK 1622) Length = 76 Score = 57.2 bits (132), Expect = 3e-07 Identities = 24/66 (36%), Positives = 42/66 (63%) Frame = +3 Query: 285 VLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPK 464 V L+++ + + E +T ++ + DLG+D LDH+E +M +ED F EIPD +AE+++ Sbjct: 5 VKLIVKDHSGADFESITPEARLIEDLGMDYLDHIEFVMDLEDTFVIEIPDEEAEKIITVG 64 Query: 465 DIVQYI 482 D Y+ Sbjct: 65 DACDYV 70 >UniRef50_Q9KQH8 Cluster: Acyl carrier protein; n=37; Bacteria|Rep: Acyl carrier protein - Vibrio cholerae Length = 78 Score = 56.8 bits (131), Expect = 4e-07 Identities = 26/70 (37%), Positives = 45/70 (64%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I+ RV ++ ++ ++ +S F+ DLG DSLD VE++MA+E+EF EIPD +AE++ Sbjct: 4 IEERVKKIIVEQLGVDEAEVKNESSFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKI 63 Query: 453 VRPKDIVQYI 482 + + Y+ Sbjct: 64 TTVQAAIDYV 73 >UniRef50_P80923 Cluster: Acyl carrier protein; n=7; Proteobacteria|Rep: Acyl carrier protein - Pseudomonas syringae pv. tomato Length = 78 Score = 56.8 bits (131), Expect = 4e-07 Identities = 26/73 (35%), Positives = 45/73 (61%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 + I+ RV ++ + E++ + F+ DLG DSLD VE++MA+E+EF EIPD +A Sbjct: 1 MSTIEERVKKIVAEQLGVKSEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA 60 Query: 444 ERLVRPKDIVQYI 482 E++ + + Y+ Sbjct: 61 EKITTVQAAIDYV 73 >UniRef50_Q7V4J6 Cluster: Acyl carrier protein; n=4; cellular organisms|Rep: Acyl carrier protein - Prochlorococcus marinus (strain MIT 9313) Length = 80 Score = 56.8 bits (131), Expect = 4e-07 Identities = 31/71 (43%), Positives = 43/71 (60%) Frame = +3 Query: 270 LIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 L K R ++ QL + ++ +S F NDLG DSLD VE++MA+E+ F EIPD AE Sbjct: 7 LEKVRSIVTEQL--SVEAGEVKPESSFQNDLGADSLDTVELVMALEEAFDIEIPDEAAEG 64 Query: 450 LVRPKDIVQYI 482 + D V+YI Sbjct: 65 ITTVGDAVKYI 75 >UniRef50_P63448 Cluster: Acyl carrier protein; n=36; Bacteria|Rep: Acyl carrier protein - Xylella fastidiosa Length = 79 Score = 56.0 bits (129), Expect = 8e-07 Identities = 28/70 (40%), Positives = 46/70 (65%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I++RV ++ ++ E++T S F+++LG DSLD VE++MA+EDEF EI D AE++ Sbjct: 4 IEARVRKIVAEKLNVDEEKVTNTSTFVDELGADSLDTVELVMALEDEFQCEIGDEAAEKM 63 Query: 453 VRPKDIVQYI 482 + + YI Sbjct: 64 TSVQHAIDYI 73 >UniRef50_Q4EAK0 Cluster: Acyl carrier protein; n=4; Wolbachia|Rep: Acyl carrier protein - Wolbachia endosymbiont of Drosophila ananassae Length = 90 Score = 54.8 bits (126), Expect = 2e-06 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = +3 Query: 351 MNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +++ G DSLD VE+IMA E+EFG EIPD DA+++ + IV+YI Sbjct: 42 LSEHGTDSLDAVEIIMAAEEEFGIEIPDEDAQKMETMEQIVEYI 85 >UniRef50_Q1ETY1 Cluster: Acyl carrier protein; n=4; Clostridiales|Rep: Acyl carrier protein - Clostridium oremlandii OhILAs Length = 76 Score = 54.8 bits (126), Expect = 2e-06 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = +3 Query: 339 DSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++ M DL DSLD VE+IM +EDEFG E+PD +A + DIV Y+ Sbjct: 25 ETSLMKDLEADSLDAVEIIMGIEDEFGIEVPDEEASKFKNIGDIVDYV 72 >UniRef50_Q9Z8P3 Cluster: Acyl carrier protein; n=2; Bacteria|Rep: Acyl carrier protein - Chlamydia pneumoniae (Chlamydophila pneumoniae) Length = 79 Score = 54.8 bits (126), Expect = 2e-06 Identities = 24/56 (42%), Positives = 38/56 (67%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++P+++ +S F+ DL DSLD E+IM +E++F FEI + DAE+L D+ YI Sbjct: 17 VDPKEVNENSSFIEDLNADSLDLTELIMTLEEKFAFEISEEDAEKLRTVGDVFTYI 72 >UniRef50_P0A4W7 Cluster: Meromycolate extension acyl carrier protein; n=14; Actinomycetales|Rep: Meromycolate extension acyl carrier protein - Mycobacterium bovis Length = 115 Score = 54.8 bits (126), Expect = 2e-06 Identities = 26/76 (34%), Positives = 45/76 (59%) Frame = +3 Query: 255 PLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 P+T + I + + +++ I P ++T + F++DL +DSL VE+ + ED++G +IPD Sbjct: 2 PVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPD 61 Query: 435 GDAERLVRPKDIVQYI 482 D L D+V YI Sbjct: 62 EDLAGLRTVGDVVAYI 77 >UniRef50_Q41D39 Cluster: Acyl carrier protein; n=1; Exiguobacterium sibiricum 255-15|Rep: Acyl carrier protein - Exiguobacterium sibiricum 255-15 Length = 79 Score = 54.4 bits (125), Expect = 2e-06 Identities = 29/75 (38%), Positives = 47/75 (62%), Gaps = 4/75 (5%) Frame = +3 Query: 270 LIKSRVLLVLQ--LYDKINPEQ--LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 + K ++L+ +Q + +K+ EQ +T+D F +DLG DSL+ +E++M +ED+F I D Sbjct: 1 MTKEQILVDVQEAIAEKLGKEQSEITLDKSFKDDLGADSLEVMELVMDLEDKFEITIEDD 60 Query: 438 DAERLVRPKDIVQYI 482 AE L D+V YI Sbjct: 61 QAENLKTVGDVVSYI 75 >UniRef50_P57433 Cluster: Acyl carrier protein; n=5; cellular organisms|Rep: Acyl carrier protein - Buchnera aphidicola subsp. Acyrthosiphon pisum (Acyrthosiphon pisumsymbiotic bacterium) Length = 80 Score = 54.4 bits (125), Expect = 2e-06 Identities = 27/70 (38%), Positives = 45/70 (64%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I+ R+ ++ I E++ D+ F++DLG DSLD VE+IMA+E+EF EI D +AE++ Sbjct: 4 IEERIKKIIFEKLDIKQEKIFNDASFIDDLGADSLDTVELIMALEEEFDIEISDEEAEKI 63 Query: 453 VRPKDIVQYI 482 + + +I Sbjct: 64 NTVQKSIDFI 73 >UniRef50_A4VD97 Cluster: Acyl carrier protein, putative; n=1; Tetrahymena thermophila SB210|Rep: Acyl carrier protein, putative - Tetrahymena thermophila SB210 Length = 160 Score = 54.0 bits (124), Expect = 3e-06 Identities = 27/70 (38%), Positives = 48/70 (68%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 LD ++++V VL+ K ++L+ + F +LG DSLD VE+++AME+ FGF+I + +A Sbjct: 63 LDEVEAKVFQVLKSAAKCKADKLSRTATF-EELGFDSLDGVELVVAMEELFGFDITNEEA 121 Query: 444 ERLVRPKDIV 473 E++V +D + Sbjct: 122 EKIVSVQDAI 131 >UniRef50_Q9WZD0 Cluster: Acyl carrier protein; n=15; Bacteria|Rep: Acyl carrier protein - Thermotoga maritima Length = 81 Score = 54.0 bits (124), Expect = 3e-06 Identities = 26/70 (37%), Positives = 43/70 (61%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I S+V ++ ++ Q+T ++ ++DLG DSLD V+++M E EFG ++ D D E++ Sbjct: 7 IFSKVKSIISEKLGVDESQVTEEAKLIDDLGADSLDLVDLVMDFESEFGVKVDDADLEKI 66 Query: 453 VRPKDIVQYI 482 DIV YI Sbjct: 67 STVGDIVSYI 76 >UniRef50_Q1JJ87 Cluster: Acyl-carrier protein; n=10; Streptococcus pyogenes|Rep: Acyl-carrier protein - Streptococcus pyogenes serotype M2 (strain MGAS10270) Length = 80 Score = 52.8 bits (121), Expect = 7e-06 Identities = 26/75 (34%), Positives = 43/75 (57%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 +T I R++ ++Q +T +H NDL +DS++ VE I+ +EDEF IPD Sbjct: 1 MTRQEIFERLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEFIINVEDEFHIAIPDE 60 Query: 438 DAERLVRPKDIVQYI 482 D E +V +D++ Y+ Sbjct: 61 DVEDMVFMRDVLDYL 75 >UniRef50_A5KP06 Cluster: Putative uncharacterized protein; n=3; Clostridiales|Rep: Putative uncharacterized protein - Ruminococcus torques ATCC 27756 Length = 103 Score = 52.0 bits (119), Expect = 1e-05 Identities = 25/53 (47%), Positives = 32/53 (60%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 E L D+ F DLG DSLD E++MA E+EFG EI D E++ KD Y+ Sbjct: 46 ETLKEDTSFKEDLGADSLDLFELVMAFEEEFGVEILSEDLEKITTIKDAAAYM 98 >UniRef50_Q4N4D2 Cluster: Acyl carrier protein, putative; n=2; Theileria|Rep: Acyl carrier protein, putative - Theileria parva Length = 141 Score = 52.0 bits (119), Expect = 1e-05 Identities = 27/72 (37%), Positives = 41/72 (56%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 D + + LV Q +DK E++ +S F + G D+LD VE+++ +EDEF IPD Sbjct: 52 DTLNTVTELVAQRFDK-KKEEIDPNSDFYKEFGADTLDKVELLILLEDEFDLNIPDNHFR 110 Query: 447 RLVRPKDIVQYI 482 L K+I +YI Sbjct: 111 TLKSIKEISRYI 122 >UniRef50_Q9RT27 Cluster: Acyl carrier protein; n=103; Bacteria|Rep: Acyl carrier protein - Deinococcus radiodurans Length = 76 Score = 52.0 bits (119), Expect = 1e-05 Identities = 26/62 (41%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +3 Query: 303 LYDKINPEQ--LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQ 476 + DK+ ++ +T ++ F+ DLG DSL+ VE+IM +ED+FG IPD AE + + V Sbjct: 11 IVDKLGVDEGKVTPEARFVEDLGADSLETVELIMGLEDKFGVTIPDEAAETIRTVQAAVD 70 Query: 477 YI 482 YI Sbjct: 71 YI 72 >UniRef50_Q6FDT7 Cluster: Acyl carrier protein; n=6; Bacteria|Rep: Acyl carrier protein - Acinetobacter sp. (strain ADP1) Length = 78 Score = 52.0 bits (119), Expect = 1e-05 Identities = 21/56 (37%), Positives = 36/56 (64%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 I E++ ++ FM+DLG DSLD VE++M+ E++F IPD D+ + + + Y+ Sbjct: 18 IKAEEIKNEASFMDDLGADSLDLVELVMSFENDFDITIPDEDSNEITTVQSAIDYV 73 >UniRef50_Q672Q9 Cluster: Acyl carrier protein precursor; n=5; Magnoliophyta|Rep: Acyl carrier protein precursor - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 133 Score = 51.2 bits (117), Expect = 2e-05 Identities = 30/76 (39%), Positives = 44/76 (57%), Gaps = 2/76 (2%) Frame = +3 Query: 261 TLDLIKS--RVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 T+D + S R L L K++PE S F DLG DSLD VE++MA+E+EFG + + Sbjct: 56 TIDKVISIVRKQLALPADTKVSPE-----STFTKDLGADSLDTVEIVMALEEEFGIAVEE 110 Query: 435 GDAERLVRPKDIVQYI 482 ++E +V +D I Sbjct: 111 ENSENIVTVQDAADLI 126 >UniRef50_Q88WK1 Cluster: Acyl carrier protein; n=14; Lactobacillales|Rep: Acyl carrier protein - Lactobacillus plantarum Length = 81 Score = 50.8 bits (116), Expect = 3e-05 Identities = 22/58 (37%), Positives = 36/58 (62%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 +++ +T + + DL DS+D VE ++ +ED FG EI D DAE+L ++V Y+A Sbjct: 19 EVDKATITNEMNLQTDLDADSIDFVEFVLELEDTFGSEISDEDAEKLSTVGEVVDYVA 76 >UniRef50_Q6A931 Cluster: Acyl carrier protein; n=1; Propionibacterium acnes|Rep: Acyl carrier protein - Propionibacterium acnes Length = 81 Score = 50.8 bits (116), Expect = 3e-05 Identities = 21/56 (37%), Positives = 38/56 (67%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++ ++T++ F++DL +DSL VE+I A +++FG EIPD +++ + D V YI Sbjct: 21 VDQSEVTLEKFFVDDLDVDSLSMVEIIYACDEKFGVEIPDEESKNIKTVGDAVNYI 76 >UniRef50_Q2LQM3 Cluster: Acyl carrier protein; n=1; Syntrophus aciditrophicus SB|Rep: Acyl carrier protein - Syntrophus aciditrophicus (strain SB) Length = 80 Score = 50.8 bits (116), Expect = 3e-05 Identities = 20/70 (28%), Positives = 44/70 (62%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 ++ +++ ++ ++ E+ ++ F+NDLG DSLD E+++ MED F EI D +++ Sbjct: 3 LEEKIIEIIVDQLEVTAEECVPEASFINDLGADSLDLAELLLEMEDTFDVEISTEDLKKI 62 Query: 453 VRPKDIVQYI 482 + +D++ Y+ Sbjct: 63 RKIQDVIDYL 72 >UniRef50_Q02B23 Cluster: Phosphopantetheine-binding; n=1; Solibacter usitatus Ellin6076|Rep: Phosphopantetheine-binding - Solibacter usitatus (strain Ellin6076) Length = 84 Score = 50.8 bits (116), Expect = 3e-05 Identities = 25/63 (39%), Positives = 39/63 (61%) Frame = +3 Query: 282 RVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRP 461 RVL V+ +I E +T+DS F LG+DS+D VE++ A+E+EF IPD + + Sbjct: 4 RVLKVIATSKRIPLETVTIDSDFQQ-LGIDSMDAVEILFALENEFDISIPDDEVRSVRNV 62 Query: 462 KDI 470 +D+ Sbjct: 63 RDM 65 >UniRef50_O83786 Cluster: Acyl carrier protein; n=10; Bacteria|Rep: Acyl carrier protein - Treponema pallidum Length = 78 Score = 50.8 bits (116), Expect = 3e-05 Identities = 25/70 (35%), Positives = 40/70 (57%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 ++ R L+ +L ++ +T+DS F DLG DSLD E++ A+E+E G IPD A Sbjct: 6 LRMRALVAEKL--EVEEASITLDSSFRGDLGADSLDTYELVYAIEEEMGITIPDEKANEF 63 Query: 453 VRPKDIVQYI 482 +D ++I Sbjct: 64 ETVRDAYEFI 73 >UniRef50_Q8XPI1 Cluster: Acyl carrier protein 3; n=1; Ralstonia solanacearum|Rep: Acyl carrier protein 3 - Ralstonia solanacearum (Pseudomonas solanacearum) Length = 87 Score = 50.4 bits (115), Expect = 4e-05 Identities = 28/76 (36%), Positives = 41/76 (53%) Frame = +3 Query: 255 PLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 P LD I+ ++ Q DK E + + F DLG DSLD VE++MA+ED+F E + Sbjct: 4 PTVLDQIRH---IIAQALDK-PVETIHAEQSFRRDLGADSLDSVEIVMAIEDQFAVEFDE 59 Query: 435 GDAERLVRPKDIVQYI 482 + +D+V YI Sbjct: 60 DSTAAVDTVQDLVTYI 75 >UniRef50_Q7XYK4 Cluster: Acyl carrier protein; n=1; Bigelowiella natans|Rep: Acyl carrier protein - Bigelowiella natans (Pedinomonas minutissima) (Chlorarachnion sp.(strain CCMP 621)) Length = 141 Score = 50.0 bits (114), Expect = 5e-05 Identities = 25/56 (44%), Positives = 36/56 (64%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 I E+++ S F DLG DSLD VE++MA+E+ FG E+P+ A + K+ V YI Sbjct: 83 IEKEKVSETSTFA-DLGADSLDTVEIVMAIEEAFGVEVPEDAAAEMSNLKEAVDYI 137 >UniRef50_Q6YPI8 Cluster: Acyl carrier protein; n=2; Candidatus Phytoplasma asteris|Rep: Acyl carrier protein - Onion yellows phytoplasma Length = 76 Score = 50.0 bits (114), Expect = 5e-05 Identities = 26/69 (37%), Positives = 39/69 (56%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLV 455 K + L+ QL ++ +T+D+ F DLGLDSLD +E++M +E F I D + Sbjct: 5 KIKALIATQL--SLDASTITLDTRFKEDLGLDSLDALELVMEVEKTFQINISDATLQNFK 62 Query: 456 RPKDIVQYI 482 +DIV YI Sbjct: 63 TVQDIVFYI 71 >UniRef50_A6LN81 Cluster: Phosphopantetheine-binding; n=1; Thermosipho melanesiensis BI429|Rep: Phosphopantetheine-binding - Thermosipho melanesiensis BI429 Length = 84 Score = 49.6 bits (113), Expect = 7e-05 Identities = 20/53 (37%), Positives = 36/53 (67%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 E + SH ++DLG DSLD V+++M +EDE+G +I D + E++ +D++ + Sbjct: 23 EDIDESSHIIDDLGADSLDVVDLVMILEDEYGIKIEDEELEQISTIEDLLNIL 75 >UniRef50_A0ZLF8 Cluster: Putative uncharacterized protein; n=1; Nodularia spumigena CCY 9414|Rep: Putative uncharacterized protein - Nodularia spumigena CCY 9414 Length = 251 Score = 49.6 bits (113), Expect = 7e-05 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 +Q+ + SH NDLG D LD E+IMA+E+EF EIPD Sbjct: 153 DQVALTSHISNDLGADVLDQTELIMAIEEEFDIEIPD 189 >UniRef50_A0BUU7 Cluster: Acyl carrier protein; n=2; Paramecium tetraurelia|Rep: Acyl carrier protein - Paramecium tetraurelia Length = 133 Score = 49.6 bits (113), Expect = 7e-05 Identities = 24/63 (38%), Positives = 43/63 (68%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 L+ + ++VL V++ K ++L+ D +LG DSLD VE+++A+E+ FGF+I + +A Sbjct: 48 LEEVTAKVLQVMKSAAKCKVDKLS-DKATFEELGFDSLDAVEMVVALEENFGFDIQNEEA 106 Query: 444 ERL 452 ER+ Sbjct: 107 ERI 109 >UniRef50_A0NL30 Cluster: Acyl-carrier protein; n=2; Oenococcus oeni|Rep: Acyl-carrier protein - Oenococcus oeni ATCC BAA-1163 Length = 84 Score = 48.8 bits (111), Expect = 1e-04 Identities = 20/56 (35%), Positives = 35/56 (62%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++ ++T D F D+ DS+D VE++M +ED++ EI D DA +L+ + V Y+ Sbjct: 20 LSKSKITPDLDFTKDVNADSIDFVELVMELEDKYDIEISDDDAAKLITFQSTVDYL 75 >UniRef50_Q22XT6 Cluster: Acyl carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Acyl carrier protein - Tetrahymena thermophila SB210 Length = 154 Score = 48.8 bits (111), Expect = 1e-04 Identities = 25/70 (35%), Positives = 41/70 (58%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 ++SR+L VL ++++N + L + +F LGLDSLD ++ ++E EF PDG E Sbjct: 79 VESRILKVLSNFEQVNLKNLRWEQNFKK-LGLDSLDQTALLASIEHEFTILFPDGVFEGF 137 Query: 453 VRPKDIVQYI 482 + +V YI Sbjct: 138 ENLEQVVNYI 147 >UniRef50_Q5PBA8 Cluster: Acyl carrier protein; n=7; Anaplasmataceae|Rep: Acyl carrier protein - Anaplasma marginale (strain St. Maries) Length = 115 Score = 48.4 bits (110), Expect = 2e-04 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 3/76 (3%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMN---DLGLDSLDHVEVIMAMEDEFGFEIPD 434 L+ IKS+V+ + K+ EQ V S N D LDSLD V++IM++E++F EI D Sbjct: 33 LEDIKSKVMEAVIGCLKLKDEQKQVLSGTTNLAKDFNLDSLDFVDLIMSLEEKFSIEITD 92 Query: 435 GDAERLVRPKDIVQYI 482 +A+ L DI +YI Sbjct: 93 EEAQGLETVDDICKYI 108 >UniRef50_Q8DWL8 Cluster: Putative acyl carrier protein; AcpP; ACP; n=1; Streptococcus mutans|Rep: Putative acyl carrier protein; AcpP; ACP - Streptococcus mutans Length = 82 Score = 48.0 bits (109), Expect = 2e-04 Identities = 20/53 (37%), Positives = 34/53 (64%) Frame = +3 Query: 327 QLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 ++TV ++ DLG+DS+ +E I+ +EDEF IPD D E + ++V Y++ Sbjct: 24 EVTVKTNIQEDLGIDSIALMEFIITLEDEFNLNIPDEDVEDIQTMGELVDYLS 76 >UniRef50_A6UAQ7 Cluster: Acyl carrier protein; n=3; Sinorhizobium medicae WSM419|Rep: Acyl carrier protein - Sinorhizobium medicae WSM419 Length = 83 Score = 47.6 bits (108), Expect = 3e-04 Identities = 23/67 (34%), Positives = 40/67 (59%) Frame = +3 Query: 282 RVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRP 461 R +++ QL INP ++ D+ ++DLG D L+ +++M +EDEF EI D AE ++ Sbjct: 13 RAIIIEQL--GINPARVVDDASIVDDLGADYLEVAQIVMMIEDEFNIEISDDLAEAVITV 70 Query: 462 KDIVQYI 482 D + + Sbjct: 71 GDAIYVV 77 >UniRef50_O34163 Cluster: Acyl carrier protein (ACP) [Contains: Beta-hemolysin]; n=3; Bacteria|Rep: Acyl carrier protein (ACP) [Contains: Beta-hemolysin] - Treponema hyodysenteriae (Serpulina hyodysenteriae) Length = 78 Score = 47.6 bits (108), Expect = 3e-04 Identities = 27/73 (36%), Positives = 41/73 (56%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 +D IK V L + DK ++T + F++DL DSLD VE+IM +E + +IP D Sbjct: 4 IDEIKDVVANQLNISDK---SKITDTASFVDDLNADSLDLVELIMELEKRYEIKIPQEDQ 60 Query: 444 ERLVRPKDIVQYI 482 E++ D +YI Sbjct: 61 EKIKNVADAAKYI 73 >UniRef50_Q9RK61 Cluster: Acyl carrier protein; n=2; Streptomyces|Rep: Acyl carrier protein - Streptomyces coelicolor Length = 92 Score = 47.6 bits (108), Expect = 3e-04 Identities = 21/65 (32%), Positives = 38/65 (58%) Frame = +3 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 L+ + + E++ DS +DLG+DSL +E++ A+ED + E+P A+RL + I Sbjct: 17 LLAATVEDLTVEEIGPDSSLQDDLGVDSLARLELVAAIEDRWQIEVPQEQADRLTTVRQI 76 Query: 471 VQYIA 485 ++A Sbjct: 77 AAHLA 81 >UniRef50_P49517 Cluster: Acyl carrier protein; n=4; cellular organisms|Rep: Acyl carrier protein - Odontella sinensis (Marine centric diatom) Length = 80 Score = 47.6 bits (108), Expect = 3e-04 Identities = 22/68 (32%), Positives = 40/68 (58%) Frame = +3 Query: 279 SRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVR 458 SR+ +++ + ++ +++ F DLG DSLD VE+IMA E+EF + D A + Sbjct: 7 SRIQSIVEEQLGVESSKIKLETDFQKDLGADSLDVVELIMAFEEEFDINVNDDAAGDIKT 66 Query: 459 PKDIVQYI 482 + +++YI Sbjct: 67 VQQVLEYI 74 >UniRef50_UPI000038CEA1 Cluster: COG0236: Acyl carrier protein; n=1; Nostoc punctiforme PCC 73102|Rep: COG0236: Acyl carrier protein - Nostoc punctiforme PCC 73102 Length = 81 Score = 47.2 bits (107), Expect = 4e-04 Identities = 20/53 (37%), Positives = 35/53 (66%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +++T+D++ + DLG D LD + + +ED F +IP +A++LV + IV YI Sbjct: 23 QKITLDANLIQDLGADYLDLIAMFQTLEDTFNTKIPHREAKQLVTVQQIVNYI 75 >UniRef50_Q88WG7 Cluster: Acyl carrier protein; n=2; Lactobacillus|Rep: Acyl carrier protein - Lactobacillus plantarum Length = 82 Score = 46.8 bits (106), Expect = 5e-04 Identities = 24/57 (42%), Positives = 36/57 (63%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 ++ +++T+ ++F DL LDSLD EVI +EDE+ EI DA L D+V Y+A Sbjct: 20 VDADKITMTTNFTEDLALDSLDVFEVIDKIEDEYDIEIETDDA--LATVGDLVDYVA 74 >UniRef50_Q9F6D5 Cluster: Acyl carrier protein; n=1; Streptomyces sp. R1128|Rep: Acyl carrier protein - Streptomyces sp. R1128 Length = 86 Score = 46.8 bits (106), Expect = 5e-04 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = +3 Query: 255 PLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 P TLD +K + + D + ++ + F+ DLGLDSL EV+ ++DE G I D Sbjct: 3 PFTLDDLKRLIDACVGTDDAVQLDETGAATPFL-DLGLDSLAVYEVVTRIQDERGVAISD 61 Query: 435 GDAERLVRPKDIVQYI 482 D + L P+D+V ++ Sbjct: 62 DDIDGLETPRDMVAFV 77 >UniRef50_O51647 Cluster: Acyl carrier protein; n=8; Bacteria|Rep: Acyl carrier protein - Borrelia burgdorferi (Lyme disease spirochete) Length = 80 Score = 46.0 bits (104), Expect = 8e-04 Identities = 25/69 (36%), Positives = 40/69 (57%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLV 455 K R ++ QL DK +++T DS F+ DL DSLD E++ +E+ F +IP+ +A Sbjct: 9 KVRSIISEQL-DK-KEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFE 66 Query: 456 RPKDIVQYI 482 D+V +I Sbjct: 67 TVGDVVNFI 75 >UniRef50_Q2LXR0 Cluster: Acyl carrier protein; n=1; Syntrophus aciditrophicus SB|Rep: Acyl carrier protein - Syntrophus aciditrophicus (strain SB) Length = 82 Score = 45.6 bits (103), Expect = 0.001 Identities = 25/63 (39%), Positives = 41/63 (65%), Gaps = 3/63 (4%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINP---EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 I ++ +L+LY K +P E+ T ++H +NDL ++S V+VI+ ED FG EI D DA Sbjct: 6 IFDELINILRLYAK-DPALLEKATKETHILNDLKVNSARLVDVIIKCEDVFGIEIDDDDA 64 Query: 444 ERL 452 +++ Sbjct: 65 DKI 67 >UniRef50_A1AMG7 Cluster: Phosphopantetheine-binding protein; n=1; Pelobacter propionicus DSM 2379|Rep: Phosphopantetheine-binding protein - Pelobacter propionicus (strain DSM 2379) Length = 88 Score = 45.6 bits (103), Expect = 0.001 Identities = 22/59 (37%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRP-KDIVQYIA 485 +I PE+L +++ DLGLDSLD V++++A+++ FG +I + + R +R +D+ +IA Sbjct: 19 EIEPERLLPEANIFVDLGLDSLDIVDLVVALQNSFGVKIRNEERIREIRTLQDLYGFIA 77 >UniRef50_Q6NG41 Cluster: Putative acyl carrier protein; n=1; Corynebacterium diphtheriae|Rep: Putative acyl carrier protein - Corynebacterium diphtheriae Length = 85 Score = 45.2 bits (102), Expect = 0.001 Identities = 25/68 (36%), Positives = 40/68 (58%) Frame = +3 Query: 279 SRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVR 458 SRV VL+ ++PE++T D+ + D G+DSLD +E+ + +E E G E+ D D Sbjct: 18 SRVCAVLKRVG-LDPEKMTPDT-VLEDAGVDSLDRIEITVRLEQESGIELHDADVFPART 75 Query: 459 PKDIVQYI 482 D++Q I Sbjct: 76 VHDLMQLI 83 >UniRef50_Q3M9C5 Cluster: Putative uncharacterized protein; n=1; Anabaena variabilis ATCC 29413|Rep: Putative uncharacterized protein - Anabaena variabilis (strain ATCC 29413 / PCC 7937) Length = 238 Score = 45.2 bits (102), Expect = 0.001 Identities = 19/43 (44%), Positives = 31/43 (72%) Frame = +3 Query: 354 NDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 NDL +D+LD +E++MA+E+EF EI D +AE + +++V I Sbjct: 191 NDLNMDNLDAIELLMAIEEEFDIEISDAEAEMVRTVQELVNII 233 >UniRef50_A0E222 Cluster: Chromosome undetermined scaffold_74, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_74, whole genome shotgun sequence - Paramecium tetraurelia Length = 877 Score = 45.2 bits (102), Expect = 0.001 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = +3 Query: 231 IRKYSGGPPLTLDLIKSRVLLVLQLYDKI-NPEQLTVDSHFMNDLGLDSLDHVEVIMAME 407 +R G + + + R++ V+ L+D + NP +T+ S + D+GL + +VEV++ +E Sbjct: 29 LRNEKSGYYVNPEAVARRMIKVISLHDDVKNPSAITLQSTW-TDIGLSDMAYVEVMVEVE 87 Query: 408 DEFGFEIPDGDA 443 EF E PD D+ Sbjct: 88 REFEIEFPDTDS 99 >UniRef50_Q92P51 Cluster: Acyl carrier protein acpXL; n=34; Rhizobiales|Rep: Acyl carrier protein acpXL - Rhizobium meliloti (Sinorhizobium meliloti) Length = 95 Score = 45.2 bits (102), Expect = 0.001 Identities = 17/40 (42%), Positives = 31/40 (77%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 +I+ E + +SH ++DLG+DSLD ++++ A++ EFG +IP Sbjct: 19 EIDRETIKPESHTIDDLGIDSLDFLDIVFAIDKEFGIKIP 58 >UniRef50_Q5M6J9 Cluster: Acyl carrier protein; n=3; Streptococcus thermophilus|Rep: Acyl carrier protein - Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) Length = 81 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/64 (29%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +3 Query: 297 LQLYDKINPEQLTV-DSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIV 473 L + ++++ E + + ++ +NDLG+DS++ +E I+ +EDEF EI D + + + D++ Sbjct: 12 LVIQEQLDREDIVLTEATKLNDLGVDSIELMEFIINLEDEFPLEISDNTIDHMDKVSDLL 71 Query: 474 QYIA 485 Y++ Sbjct: 72 DYLS 75 >UniRef50_Q48BT2 Cluster: Acyl carrier protein; n=1; Pseudomonas syringae pv. phaseolicola 1448A|Rep: Acyl carrier protein - Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) Length = 78 Score = 44.4 bits (100), Expect = 0.003 Identities = 22/71 (30%), Positives = 39/71 (54%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I+++V+ +L ++ ++ + DL D LD E +MA++ EFGF I D + L Sbjct: 4 IEAKVIAILSEKLGLSESRIKPTDRLVEDLNSDDLDFAEAVMALQVEFGFMILDKEYLEL 63 Query: 453 VRPKDIVQYIA 485 +DIV Y++ Sbjct: 64 KTVQDIVDYVS 74 >UniRef50_Q1Q262 Cluster: Similar to acyl carrier protein; n=1; Candidatus Kuenenia stuttgartiensis|Rep: Similar to acyl carrier protein - Candidatus Kuenenia stuttgartiensis Length = 83 Score = 44.4 bits (100), Expect = 0.003 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSHFM--NDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 K + LLV +L KI +Q+ D+ N LGLDS+D +E+I+A++ EFG EI D + Sbjct: 7 KLKELLVTKLKLKIGVDQIKEDTLLFGSNSLGLDSIDVLELIIAIKKEFGVEIMDRETSE 66 Query: 450 LV 455 V Sbjct: 67 QV 68 >UniRef50_A7P6D9 Cluster: Chromosome chr9 scaffold_7, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr9 scaffold_7, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 156 Score = 44.4 bits (100), Expect = 0.003 Identities = 28/76 (36%), Positives = 42/76 (55%) Frame = +3 Query: 255 PLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 P TL ++S + L I +LT +S F DLG DSLD VE++MA+E++FG I + Sbjct: 79 PETLQAVQSTIAKQLS----IEESRLTPESKFA-DLGADSLDIVEIMMALEEKFGVAIGE 133 Query: 435 GDAERLVRPKDIVQYI 482 A+ + +D I Sbjct: 134 EGAQNIHTVQDAANLI 149 >UniRef50_O68916 Cluster: Acyl carrier protein; n=1; Streptomyces roseofulvus|Rep: Acyl carrier protein - Streptomyces roseofulvus Length = 85 Score = 43.6 bits (98), Expect = 0.004 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = +3 Query: 291 LVLQLYDKINPEQL---TVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRP 461 LV Q YD + E L +D+ F DLG DSL E++ ++DE G +PD + + L P Sbjct: 12 LVEQSYDAESAEALHGQALDTSF-TDLGYDSLTVYEIVTRIQDEHGVTVPDEELDLLDTP 70 Query: 462 KDIVQYI 482 + ++ Y+ Sbjct: 71 RALIAYV 77 >UniRef50_A4ZY17 Cluster: Putative uncharacterized protein; n=1; Rhodococcus sp. DK17|Rep: Putative uncharacterized protein - Rhodococcus sp. DK17 Length = 105 Score = 43.6 bits (98), Expect = 0.004 Identities = 20/67 (29%), Positives = 34/67 (50%) Frame = +3 Query: 285 VLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPK 464 VL L + ++ + + D + + LDSLD + ++ + FG +IP+ D RLV Sbjct: 10 VLAALPSHPEVEGDDVLADQPHRDQVDLDSLDWLNFLVRLHSNFGIDIPEADYGRLVTLT 69 Query: 465 DIVQYIA 485 D+ Y A Sbjct: 70 DVTDYAA 76 >UniRef50_A2U5G8 Cluster: Putative uncharacterized protein; n=1; Bacillus coagulans 36D1|Rep: Putative uncharacterized protein - Bacillus coagulans 36D1 Length = 109 Score = 43.6 bits (98), Expect = 0.004 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Frame = +3 Query: 273 IKSRVL-LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 I+ RV +VL +D +P ++ D+ F++DLG D +D E+ + + DEF F+I + + + Sbjct: 11 IRERVRDIVLNDFDD-DPSEIKDDTLFVDDLGADWIDLSELAVELSDEFDFDIEEDEINK 69 Query: 450 LVRPKDIVQYI 482 LV + YI Sbjct: 70 LVSIEKATDYI 80 >UniRef50_P11830 Cluster: Acyl carrier protein; n=3; Saccharopolyspora erythraea|Rep: Acyl carrier protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 95 Score = 43.6 bits (98), Expect = 0.004 Identities = 23/58 (39%), Positives = 32/58 (55%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 I R+ VL I EQ+T ++ DLG+DSLD VE++ A+EDE G + E Sbjct: 6 IFERIEQVLAEQLGIPAEQITEEADLREDLGMDSLDLVELVSALEDEVGMRVEQSQLE 63 >UniRef50_Q4JWI6 Cluster: AcpM protein; n=1; Corynebacterium jeikeium K411|Rep: AcpM protein - Corynebacterium jeikeium (strain K411) Length = 113 Score = 43.2 bits (97), Expect = 0.006 Identities = 29/97 (29%), Positives = 49/97 (50%) Frame = +3 Query: 183 KIYKSQALQNGNEKHGIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDL 362 K+ K A ++G K G +G +S VL V++ I E+L +DL Sbjct: 15 KLKKDGADKSGTSKAGKDGSAGADEKDK---RSIVLDVVEDATGIEREELEGSKRLGDDL 71 Query: 363 GLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIV 473 +DSL +++ + +E+EFG E+PD D R+ ++V Sbjct: 72 NIDSLSLMDIAVRLEEEFGVEVPDEDINRVKTIDELV 108 >UniRef50_Q47CJ2 Cluster: Phosphopantetheine-binding; n=1; Dechloromonas aromatica RCB|Rep: Phosphopantetheine-binding - Dechloromonas aromatica (strain RCB) Length = 88 Score = 43.2 bits (97), Expect = 0.006 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +3 Query: 258 LTLDLIKSRVL-LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 L + I++ VL +V +L +I+P ++ D + LDS+D + V+ ++ ++ G +IP+ Sbjct: 3 LNSEQIRAAVLAIVKRLAPEIDPAKIIADKPLRTQIDLDSMDWLNVLASIHEKLGIDIPE 62 Query: 435 GDAERLVRPKDIVQYIA 485 D ++ IV Y+A Sbjct: 63 TDYGKVQTLDSIVTYLA 79 >UniRef50_Q6AM38 Cluster: Related to acyl carrier protein; n=3; Deltaproteobacteria|Rep: Related to acyl carrier protein - Desulfotalea psychrophila Length = 86 Score = 42.7 bits (96), Expect = 0.008 Identities = 19/58 (32%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLV-RPKDIVQYI 482 ++N E++T ++ +LGLDSLD V++++ +E FG ++ D R + KD+ ++I Sbjct: 19 ELNREEMTPEASLYEELGLDSLDAVDMVIVLEKTFGLKLADEKEIRSIWTLKDLAEFI 76 >UniRef50_Q9FD17 Cluster: Acyl carrier protein; n=2; Streptomyces|Rep: Acyl carrier protein - Streptomyces collinus Length = 87 Score = 42.7 bits (96), Expect = 0.008 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = +3 Query: 324 EQLTVDS-HFMN----DLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 EQ +D HF + DLG DSL +E++ +E E+G +IPDGD P++ + Y+ Sbjct: 21 EQTDLDGEHFADTSFADLGYDSLALLELVNRIEREYGIQIPDGDLSHTQTPREALTYV 78 >UniRef50_A0C2J6 Cluster: Acyl carrier protein; n=2; Paramecium tetraurelia|Rep: Acyl carrier protein - Paramecium tetraurelia Length = 139 Score = 42.7 bits (96), Expect = 0.008 Identities = 24/67 (35%), Positives = 37/67 (55%) Frame = +3 Query: 282 RVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRP 461 R L VL+ +DKI+ +Q+ + DLGLDSL+ + +I ++E EF D + L Sbjct: 66 RFLKVLKSFDKIDVKQINWEGDLNKDLGLDSLERIALITSIEHEFTAIFEDRVFDNLKSL 125 Query: 462 KDIVQYI 482 +DI I Sbjct: 126 QDIKNQI 132 >UniRef50_Q8FNJ5 Cluster: Putative acyl carrier protein; n=1; Corynebacterium efficiens|Rep: Putative acyl carrier protein - Corynebacterium efficiens Length = 97 Score = 42.3 bits (95), Expect = 0.010 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++ E +T + DL + SL+ +E ++ +ED FG I D D + DIV ++ Sbjct: 33 VSAEDITTTARLREDLAISSLNLIEAVVRVEDAFGVRIEDADVQGFTTTGDIVDFL 88 >UniRef50_Q2L5R3 Cluster: Putative acyl carrier protein; n=1; Clostridium perfringens|Rep: Putative acyl carrier protein - Clostridium perfringens Length = 81 Score = 42.3 bits (95), Expect = 0.010 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFG--FEIPDGDAE 446 I RV+ +L ++ ++ D + + DLG DSLD ++ I+ +EDEF FE + + E Sbjct: 5 IMKRVINILSNNERFKSSEVNYDLNLIKDLGFDSLDIMKFIVELEDEFNIMFEPEELEYE 64 Query: 447 RLVRPKDIVQYI 482 ++ K++ I Sbjct: 65 NIINIKNLCDLI 76 >UniRef50_A1G352 Cluster: Phosphopantetheine-binding; n=1; Salinispora arenicola CNS205|Rep: Phosphopantetheine-binding - Salinispora arenicola CNS205 Length = 88 Score = 42.3 bits (95), Expect = 0.010 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFE 425 + R + VL + P+ L D+ DLG+DS + +E++M +EDEFGFE Sbjct: 11 LAERTVRVLAGVVQREPQTLHQDTRLFADLGMDSTNALELLMMLEDEFGFE 61 >UniRef50_Q5CBJ4 Cluster: Acyl carrier protein; n=10; Thermotogaceae|Rep: Acyl carrier protein - Thermotoga petrophila Length = 93 Score = 41.9 bits (94), Expect = 0.014 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +3 Query: 309 DKINPEQLTVDSHF-MNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +K+ + TVD +LG DS+D ++++M EDEF I D + ++ + KD++ + Sbjct: 21 EKMGKDLETVDEESTFEELGFDSIDVIDLVMFFEDEFALRIEDEEISKIRKVKDLIDIV 79 >UniRef50_A5ZMX6 Cluster: Putative uncharacterized protein; n=1; Ruminococcus obeum ATCC 29174|Rep: Putative uncharacterized protein - Ruminococcus obeum ATCC 29174 Length = 76 Score = 41.9 bits (94), Expect = 0.014 Identities = 16/63 (25%), Positives = 35/63 (55%) Frame = +3 Query: 294 VLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIV 473 ++ Y K+ PE++T + F DLG SLD + + +ED F E+ + + ++ ++ + Sbjct: 10 IVAQYSKVKPEEMTGEMRFREDLGFTSLDFMSFLGELEDTFDIELEETEVTQITTLEEAL 69 Query: 474 QYI 482 + + Sbjct: 70 KLL 72 >UniRef50_Q5ENV3 Cluster: Chloroplast acyl carrier protein; n=1; Heterocapsa triquetra|Rep: Chloroplast acyl carrier protein - Heterocapsa triquetra (Dinoflagellate) Length = 116 Score = 41.9 bits (94), Expect = 0.014 Identities = 19/42 (45%), Positives = 26/42 (61%) Frame = +3 Query: 357 DLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +LG DSLD VE +MAME+ F E+PD + +L D+ I Sbjct: 71 ELGADSLDIVETVMAMEEAFDVELPDEETTQLKNVGDVADLI 112 >UniRef50_A7AWQ5 Cluster: Nucleolar GTP-binding protein 2, putative; n=1; Babesia bovis|Rep: Nucleolar GTP-binding protein 2, putative - Babesia bovis Length = 671 Score = 41.9 bits (94), Expect = 0.014 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 312 KINPEQLTVDSH--FMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 K E VD F+ + D LD VEV++++E+EF IPD D L K+I Y+ Sbjct: 603 KFGQEAKNVDPSCKFLQEFDADQLDEVEVLLSIEEEFDLTIPDYDFAELRTIKEIADYL 661 >UniRef50_Q9X5S0 Cluster: MmcB; n=1; Streptomyces lavendulae|Rep: MmcB - Streptomyces lavendulae Length = 93 Score = 41.5 bits (93), Expect = 0.018 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 3/75 (4%) Frame = +3 Query: 258 LTLDLIKSRV--LLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 LT D IK R+ +LV L ++P + D + LGLDS++ +E ++ +E EFG EI Sbjct: 4 LTTDKIKDRLRKVLVDSLELSLDPSAVP-DEGLVEKLGLDSINTIEFLIWVESEFGIEIA 62 Query: 432 DGDAE-RLVRPKDIV 473 D D +L+ D++ Sbjct: 63 DEDLSIKLIDSLDLL 77 >UniRef50_A5IHN6 Cluster: Acyl carrier protein; n=5; Legionella pneumophila|Rep: Acyl carrier protein - Legionella pneumophila (strain Corby) Length = 137 Score = 41.5 bits (93), Expect = 0.018 Identities = 16/48 (33%), Positives = 32/48 (66%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVR 458 I+ E+++++S + DLG +S+D ++++ +E EF +IP G E+ R Sbjct: 20 IDEEEISLNSSLIEDLGAESIDFLDLVFQLEKEFKIKIPRGQLEKNAR 67 >UniRef50_A0YWZ6 Cluster: Putative uncharacterized protein; n=1; Lyngbya sp. PCC 8106|Rep: Putative uncharacterized protein - Lyngbya sp. PCC 8106 Length = 475 Score = 41.5 bits (93), Expect = 0.018 Identities = 26/69 (37%), Positives = 41/69 (59%), Gaps = 9/69 (13%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDS---------LDHVEVIMAMEDEFGFE 425 +K R +L +L ++ E++ +DS DLGL S LDH+E+ MA+E+EF E Sbjct: 379 LKLRRVLAEELL--VDEEEVKLDSDIEYDLGLGSRSTYGLDYGLDHIELAMAIEEEFEIE 436 Query: 426 IPDGDAERL 452 IPD A+++ Sbjct: 437 IPDDVADKI 445 Score = 40.3 bits (90), Expect = 0.041 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRP 461 E + +DS DLG D D E+ MA+E+EF EI D + E++ P Sbjct: 171 EDVNLDSQIEYDLGADWADRTEIPMAIEEEFEIEISDEEIEKIHFP 216 >UniRef50_Q6AET1 Cluster: Acyl carrier protein; n=1; Leifsonia xyli subsp. xyli|Rep: Acyl carrier protein - Leifsonia xyli subsp. xyli Length = 83 Score = 41.1 bits (92), Expect = 0.024 Identities = 18/56 (32%), Positives = 33/56 (58%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 I E + +D F +DL +DS+ + +++ ED+F +IPD + + L D V++I Sbjct: 22 IATETVELDKSFTDDLDIDSISMMTIVVNAEDKFDVKIPDEEVKNLKTVGDAVEFI 77 >UniRef50_Q0A9U8 Cluster: Phosphopantetheine-binding; n=1; Alkalilimnicola ehrlichei MLHE-1|Rep: Phosphopantetheine-binding - Alkalilimnicola ehrlichei (strain MLHE-1) Length = 98 Score = 41.1 bits (92), Expect = 0.024 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Frame = +3 Query: 300 QLYDKINPEQLTV---DSH-FMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKD 467 +L +I PE + D H F DL +DS+D + +++ +E G +IPDGD +L P Sbjct: 14 RLLAEITPETVLAEVQDDHSFHEDLDMDSVDFLRLMLGLEQALGVKIPDGDYTQLSTPGG 73 Query: 468 IVQYI 482 +Y+ Sbjct: 74 CRRYL 78 >UniRef50_A3VAJ7 Cluster: Acyl carrier protein; n=1; Rhodobacterales bacterium HTCC2654|Rep: Acyl carrier protein - Rhodobacterales bacterium HTCC2654 Length = 87 Score = 41.1 bits (92), Expect = 0.024 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = +3 Query: 294 VLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 ++ + + +++ DSH + DL LDS+D +V+ A+E EF E+P Sbjct: 4 IIAEWSDVERDEIREDSHLVEDLKLDSVDLFDVVFALEREFDIELP 49 >UniRef50_P11829 Cluster: Acyl carrier protein 1, chloroplast precursor; n=25; core eudicotyledons|Rep: Acyl carrier protein 1, chloroplast precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 137 Score = 41.1 bits (92), Expect = 0.024 Identities = 18/67 (26%), Positives = 37/67 (55%) Frame = +3 Query: 282 RVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRP 461 +V +++ + P++ V DLG DSLD VE++M +E+EF ++ + A+++ Sbjct: 63 KVSAIVKKQLSLTPDKKVVAETKFADLGADSLDTVEIVMGLEEEFNIQMAEEKAQKIATV 122 Query: 462 KDIVQYI 482 + + I Sbjct: 123 EQAAELI 129 >UniRef50_Q2T6Q9 Cluster: AMP-binding domain protein; n=1; Burkholderia thailandensis E264|Rep: AMP-binding domain protein - Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 /CIP 106301) Length = 1035 Score = 40.7 bits (91), Expect = 0.031 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 1/112 (0%) Frame = +3 Query: 153 QKFSTIKAAVKIYKSQALQNGNEKHGIRKYSGGPPLTLDLIKSRVLLVLQLYDKINPE-Q 329 ++ T A + +S ++ ++ S L LI + L+ +LY + N + Sbjct: 68 KRADTADARRRCARSPIIERATSMEHTQRLSDNATRLLALIDA---LLAELYGERNGHGR 124 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 T+D+ F DLG DSL E+ +E FG +P P D+V+ +A Sbjct: 125 ATLDARFERDLGFDSLTRAELFDRIERAFGVRLPVDVFASAATPADVVRALA 176 >UniRef50_Q127J0 Cluster: AMP-dependent synthetase and ligase; n=5; Proteobacteria|Rep: AMP-dependent synthetase and ligase - Polaromonas sp. (strain JS666 / ATCC BAA-500) Length = 942 Score = 40.7 bits (91), Expect = 0.031 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQ 476 +T+DS DLGLDSL VE++M +E FG P+ P+D+++ Sbjct: 36 VTLDSSLEEDLGLDSLARVELLMRLERAFGVRPPEHMLSTAEAPRDLLR 84 >UniRef50_A6P1J4 Cluster: Putative uncharacterized protein; n=1; Bacteroides capillosus ATCC 29799|Rep: Putative uncharacterized protein - Bacteroides capillosus ATCC 29799 Length = 76 Score = 40.7 bits (91), Expect = 0.031 Identities = 20/53 (37%), Positives = 30/53 (56%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 E +T+++ DLG DSL VE+ MA+E+ G I D D + D++ YI Sbjct: 19 EDVTMEAKLSEDLGADSLAAVELSMALEEASGVTIEDDDLPNMKTVGDLMAYI 71 >UniRef50_Q5YBE5 Cluster: Plastid acyl carrier protein; n=1; Helicosporidium sp. ex Simulium jonesii|Rep: Plastid acyl carrier protein - Helicosporidium sp. subsp. Simulium jonesii (Green alga) Length = 128 Score = 40.7 bits (91), Expect = 0.031 Identities = 27/74 (36%), Positives = 42/74 (56%) Frame = +3 Query: 261 TLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 TL L R ++ QL + EQ+ S F+ DL DSLD VE+++A+E++F + D + Sbjct: 53 TLVLDDVRSIIADQLGKDV--EQVHPTSKFV-DLNADSLDTVEIMLALEEKFDVSLDDEN 109 Query: 441 AERLVRPKDIVQYI 482 AE+L +D I Sbjct: 110 AEKLSTVQDAADLI 123 >UniRef50_P80921 Cluster: Acyl carrier protein; n=24; Bacteria|Rep: Acyl carrier protein - Myxococcus xanthus Length = 79 Score = 40.7 bits (91), Expect = 0.031 Identities = 16/56 (28%), Positives = 34/56 (60%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++ ++ + F +DL +DS+ + +++ ED+FG +IPD + + L +D V +I Sbjct: 21 LDTAEVQPEKSFTDDLDIDSISMMTIVVNAEDKFGVKIPDEEVKNLKTVQDAVDFI 76 >UniRef50_Q74GK4 Cluster: Acyl carrier protein; n=5; Geobacter|Rep: Acyl carrier protein - Geobacter sulfurreducens Length = 85 Score = 40.3 bits (90), Expect = 0.041 Identities = 17/55 (30%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMND-LGLDSLDHVEVIMAMEDEFGFEIPD 434 +K ++ L++ + ++P+ + D+ + LGLDS+D +++++AME +FG +PD Sbjct: 9 VKQMIIDALRI-EGMSPDDIDTDAPLFGEGLGLDSIDALQLVVAMEKDFGVVVPD 62 >UniRef50_Q93I56 Cluster: Iturin A synthetase A; n=6; Bacillus|Rep: Iturin A synthetase A - Bacillus subtilis Length = 3982 Score = 40.3 bits (90), Expect = 0.041 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP-DGDAER 449 I+S + V+ I E+L +++HF+ LG+DS+ +V A+ DEFG +IP D + Sbjct: 1291 IESFLKTVISNASGIRAEELDLNAHFIG-LGMDSIMLSQVKKAIADEFGVDIPMDRFFDT 1349 Query: 450 LVRPKDIVQYIA 485 L + ++ Y+A Sbjct: 1350 LTNLQSVIDYLA 1361 >UniRef50_A1AMI2 Cluster: Acyl-carrier protein-like protein; n=1; Pelobacter propionicus DSM 2379|Rep: Acyl-carrier protein-like protein - Pelobacter propionicus (strain DSM 2379) Length = 94 Score = 40.3 bits (90), Expect = 0.041 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMND-LGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 +K + L L D I PE++ D D LGLDSLD VE+++ ++ FG EI + D R Sbjct: 15 LKEMIARDLALED-ITPEEIGDDEILFGDGLGLDSLDAVEIVVLLQRNFGVEIKNMDQGR 73 >UniRef50_Q6RKI4 Cluster: Polyketide synthase; n=2; Botryotinia fuckeliana|Rep: Polyketide synthase - Botrytis cinerea (Noble rot fungus) (Botryotinia fuckeliana) Length = 2411 Score = 40.3 bits (90), Expect = 0.041 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Frame = +3 Query: 294 VLQLYDKI--NPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKD 467 VLQ+ +I P DS + DLG+DSL VE+ +ED F EI D D K+ Sbjct: 1597 VLQMISEICGAPIDEIRDSAALQDLGVDSLSAVELKSELEDAFSIEIDDDDLSLESTVKE 1656 Query: 468 IVQYI 482 +++Y+ Sbjct: 1657 VLKYL 1661 Score = 33.9 bits (74), Expect = 3.6 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +3 Query: 249 GPPLTLDLIKSRVLL--VLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGF 422 GPP DL+ L ++ Y ++ ++ D++ + DLG+DSL VE+ ++ +FG Sbjct: 1478 GPPTPTDLVSGADNLKNLIASYTGLSDTEIIDDAN-IGDLGVDSLAAVELAEELQAKFGK 1536 Query: 423 EIPDGD 440 EI D Sbjct: 1537 EIASED 1542 >UniRef50_Q6RKE3 Cluster: Polyketide synthase; n=2; Fungi/Metazoa group|Rep: Polyketide synthase - Cochliobolus heterostrophus (Drechslera maydis) Length = 2528 Score = 40.3 bits (90), Expect = 0.041 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = +3 Query: 339 DSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 DSH + DLG+DSL VE+ +E+ F +I + D DIV+Y+ Sbjct: 1918 DSHTLRDLGVDSLASVELTSDLENAFSIQIDESDLHLDSTVADIVEYL 1965 Score = 33.1 bits (72), Expect = 6.3 Identities = 19/64 (29%), Positives = 33/64 (51%) Frame = +3 Query: 243 SGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGF 422 + P + I+ RV+ ++ E + D+ + DLG+DSL +E+ +EDEF Sbjct: 1995 AAAPQSESNAIRQRVIQIISDACGAPAEDIGEDA-LLRDLGVDSLAAMELKSELEDEFNV 2053 Query: 423 EIPD 434 E+ D Sbjct: 2054 ELDD 2057 >UniRef50_P07854 Cluster: Acyl carrier protein 1, chloroplast precursor; n=2; core eudicotyledons|Rep: Acyl carrier protein 1, chloroplast precursor - Spinacia oleracea (Spinach) Length = 138 Score = 40.3 bits (90), Expect = 0.041 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 +T DS F + LG DSLD VE++M +E+EFG + + A+ Sbjct: 81 VTADSEF-SKLGADSLDTVEIVMNLEEEFGINVDEDKAQ 118 >UniRef50_Q9F7T4 Cluster: Acyl carrier protein; n=13; Streptococcus|Rep: Acyl carrier protein - Streptococcus pneumoniae Length = 77 Score = 39.9 bits (89), Expect = 0.055 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +3 Query: 354 NDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +DL DS+D +E I+ +EDEF EI D + ++L D+V+ I Sbjct: 32 DDLDADSVDLMEFILTLEDEFSIEISDEEIDQLQNVGDVVKII 74 >UniRef50_Q6ALF3 Cluster: Related to acyl carrier protein; n=2; Desulfotalea psychrophila|Rep: Related to acyl carrier protein - Desulfotalea psychrophila Length = 81 Score = 39.9 bits (89), Expect = 0.055 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +3 Query: 273 IKSRVLLVLQ-LYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 IK +L LQ + + + + L D + + L +DS D + + + +E G EIP+ D + Sbjct: 6 IKETILRALQPITPEADLDGLAADENMQDALDIDSFDVLTFFVKLYEELGVEIPEEDYGQ 65 Query: 450 LVRPKDIVQYIA 485 ++ D++ Y+A Sbjct: 66 IITLNDLIGYLA 77 >UniRef50_O67119 Cluster: Long-chain-fatty-acid CoA ligase; n=1; Aquifex aeolicus|Rep: Long-chain-fatty-acid CoA ligase - Aquifex aeolicus Length = 823 Score = 39.9 bits (89), Expect = 0.055 Identities = 17/64 (26%), Positives = 37/64 (57%) Frame = +3 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 ++ + +KI+ +++ H DLGLDSL VE++ +E FG + + + + + KD+ Sbjct: 528 IIKEFLEKISQKEVKPGDHLEIDLGLDSLAKVELLGFIETNFGVSLSEEELSKNLVVKDL 587 Query: 471 VQYI 482 ++ + Sbjct: 588 IELV 591 >UniRef50_A7LTN9 Cluster: Putative uncharacterized protein; n=1; Bacteroides ovatus ATCC 8483|Rep: Putative uncharacterized protein - Bacteroides ovatus ATCC 8483 Length = 93 Score = 39.9 bits (89), Expect = 0.055 Identities = 20/57 (35%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMND--LGLDSLDHVEVIMAMEDEFGFEI 428 +D +K +++ L L ++I PE + ++ D LGLDS+D +E+I+ +E E+G +I Sbjct: 12 MDEVKGKLIEELNL-EEITPEDIDNEAPLFGDEGLGLDSIDALEIILILEREYGIKI 67 >UniRef50_A0LPN4 Cluster: Phosphopantetheine-binding precursor; n=1; Syntrophobacter fumaroxidans MPOB|Rep: Phosphopantetheine-binding precursor - Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) Length = 124 Score = 39.9 bits (89), Expect = 0.055 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 ++ E++T +++ M DLG +S+D +E+ +A+ FG EI D Sbjct: 17 VDTEEITPETYLMRDLGAESIDQLELSVALNARFGIEIND 56 >UniRef50_A5BLR3 Cluster: Acyl carrier protein; n=4; core eudicotyledons|Rep: Acyl carrier protein - Vitis vinifera (Grape) Length = 139 Score = 39.9 bits (89), Expect = 0.055 Identities = 19/51 (37%), Positives = 30/51 (58%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +T +S F LG DSLD VE++M +E+EFG + + A+ + +D I Sbjct: 81 ITGESKFAA-LGADSLDTVEIVMGLEEEFGINVEEESAQSIATVQDAADLI 130 >UniRef50_A4S5H6 Cluster: Acyl carrier protein; n=3; Chlorophyta|Rep: Acyl carrier protein - Ostreococcus lucimarinus CCE9901 Length = 121 Score = 39.9 bits (89), Expect = 0.055 Identities = 25/74 (33%), Positives = 44/74 (59%) Frame = +3 Query: 261 TLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 TLD K R ++ QL ++ + + D+ F+ DLG DSLD VE++MA+E++F + + Sbjct: 49 TLD--KVRGIISEQLGTEL--DAVAADAKFV-DLGADSLDTVEIMMALEEQFEITLDEEG 103 Query: 441 AERLVRPKDIVQYI 482 AE++ ++ I Sbjct: 104 AEKIATVQEAADMI 117 >UniRef50_Q83NH7 Cluster: Acyl carrier protein; n=7; Actinobacteria (class)|Rep: Acyl carrier protein - Tropheryma whipplei (strain TW08/27) (Whipple's bacillus) Length = 82 Score = 39.9 bits (89), Expect = 0.055 Identities = 17/56 (30%), Positives = 32/56 (57%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 I+ + +D F++DL +DS+ + +++ E+++G EIPD L D V +I Sbjct: 22 IDKGSVQLDKAFVDDLDIDSISMMTIVVNAEEKYGIEIPDDKVRELRTVGDAVDFI 77 >UniRef50_P02902 Cluster: Acyl carrier protein 1, chloroplast precursor; n=25; Magnoliophyta|Rep: Acyl carrier protein 1, chloroplast precursor - Hordeum vulgare (Barley) Length = 149 Score = 39.9 bits (89), Expect = 0.055 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +T +S F ++LG DSLD VE++M +E+EF + + A+ + +D I Sbjct: 91 VTAESKF-SELGADSLDTVEIVMGLEEEFNITVDETSAQDIATVQDAANLI 140 >UniRef50_Q2GDV9 Cluster: Acyl carrier protein; n=1; Neorickettsia sennetsu str. Miyayama|Rep: Acyl carrier protein - Neorickettsia sennetsu (strain Miyayama) Length = 144 Score = 39.5 bits (88), Expect = 0.072 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGF-EIPDGDAER 449 +K V+ L L D+ +++ +++ ++LG+DSLD E+IM +E++ EIP+ A + Sbjct: 17 VKVSVMGALNLSDE-KYDEIKLETDLSSELGIDSLDAAEIIMRVEEDHDLEEIPEDYARK 75 Query: 450 LVRPKDIVQYI 482 K I Y+ Sbjct: 76 ANTVKHIYDYL 86 >UniRef50_A6PQN8 Cluster: Acyl carrier protein-like protein; n=1; Victivallis vadensis ATCC BAA-548|Rep: Acyl carrier protein-like protein - Victivallis vadensis ATCC BAA-548 Length = 92 Score = 39.5 bits (88), Expect = 0.072 Identities = 16/57 (28%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEI-PDGDAERLVRPKDIVQY 479 +++P +LT + +DLGLDSLD V++++ ++ +FG + + + ++V D+ ++ Sbjct: 19 ELDPAELTAEKKIFDDLGLDSLDIVDLMIGLQRKFGIPLRQNEEIRKIVTLGDVYEF 75 >UniRef50_A4A0E1 Cluster: Serine/threonine-protein kinase; n=1; Blastopirellula marina DSM 3645|Rep: Serine/threonine-protein kinase - Blastopirellula marina DSM 3645 Length = 424 Score = 39.5 bits (88), Expect = 0.072 Identities = 24/64 (37%), Positives = 35/64 (54%) Frame = +3 Query: 243 SGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGF 422 S G L L+L+ RV V I +++ S + DL DSLD VE+++ +E+EF Sbjct: 2 SNGGWLDLNLVVERVADVASRQLCIPRDEIDSTSRLVEDLQCDSLDLVELLIELEEEFLV 61 Query: 423 EIPD 434 IPD Sbjct: 62 TIPD 65 >UniRef50_A2YXU7 Cluster: Acyl carrier protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Acyl carrier protein - Oryza sativa subsp. indica (Rice) Length = 103 Score = 39.5 bits (88), Expect = 0.072 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +3 Query: 354 NDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +DLG DSLD VE++M +E+EF + + A+ + +D I Sbjct: 47 SDLGADSLDTVEIVMGLEEEFHISVEESSAQSIATVEDAAALI 89 >UniRef50_Q1K0P7 Cluster: Phosphopantetheine-binding; n=1; Desulfuromonas acetoxidans DSM 684|Rep: Phosphopantetheine-binding - Desulfuromonas acetoxidans DSM 684 Length = 84 Score = 39.1 bits (87), Expect = 0.096 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEI-PDGDAERLVRPKDIVQYIA 485 +++ +++T D DLGLDSLD V++++ +E F F+I + D + + DI ++A Sbjct: 19 ELDLDEMTPDVSLYEDLGLDSLDTVDMVIVLEGAFKFKIREEADVKEIRTLGDIHAFVA 77 >UniRef50_Q1GHB3 Cluster: Phosphopantetheine-binding; n=9; Alphaproteobacteria|Rep: Phosphopantetheine-binding - Silicibacter sp. (strain TM1040) Length = 85 Score = 39.1 bits (87), Expect = 0.096 Identities = 19/52 (36%), Positives = 32/52 (61%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 + +V+ ++ + P +++DS + DLG+DSL VE I A+E+EF IP Sbjct: 4 QDKVIAIIAEQAVLEPSDVSLDST-LEDLGIDSLGLVESIFAIEEEFDISIP 54 >UniRef50_A4VSA8 Cluster: Acyl carrier protein; n=3; Streptococcus suis|Rep: Acyl carrier protein - Streptococcus suis (strain 05ZYH33) Length = 82 Score = 39.1 bits (87), Expect = 0.096 Identities = 21/75 (28%), Positives = 42/75 (56%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 +T + + RV+ ++Q +K Q+ +S +++ DS++ +E ++ +EDEF ++PD Sbjct: 1 MTREQVYQRVVELIQ-DEKGEDFQVQPESTLADNIAADSVEIMEFVLNLEDEFHVDVPDA 59 Query: 438 DAERLVRPKDIVQYI 482 E DIV +I Sbjct: 60 AIEHFEVLSDIVDFI 74 >UniRef50_A1AP60 Cluster: Phosphopantetheine-binding; n=2; Desulfuromonadales|Rep: Phosphopantetheine-binding - Pelobacter propionicus (strain DSM 2379) Length = 81 Score = 39.1 bits (87), Expect = 0.096 Identities = 19/57 (33%), Positives = 30/57 (52%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 K+ PE L ++ NDL LDSL E+++ ED FG E +A + ++ +I Sbjct: 18 KLAPEDLKPEADLRNDLRLDSLALAELLVLTEDSFGVEFSPEEAHSVATLGQMIDFI 74 >UniRef50_Q8EVZ1 Cluster: Acyl carrier protein; n=1; Mycoplasma penetrans|Rep: Acyl carrier protein - Mycoplasma penetrans Length = 80 Score = 38.7 bits (86), Expect = 0.13 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 1/76 (1%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQL-YDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 +T++ I + V VL+ + + ++S+ + DLGL+SLD +E+I+ +E++ +PD Sbjct: 1 MTIEQITTEVNKVLEKNHSSLKINNKNINSN-LKDLGLNSLDMLEMIVQVEEQLKISLPD 59 Query: 435 GDAERLVRPKDIVQYI 482 + P D++ I Sbjct: 60 EKLIEIKTPSDLLNLI 75 >UniRef50_Q7MZB2 Cluster: D-alanine carrier protein DltC; n=1; Photorhabdus luminescens subsp. laumondii|Rep: D-alanine carrier protein DltC - Photorhabdus luminescens subsp. laumondii Length = 74 Score = 38.7 bits (86), Expect = 0.13 Identities = 19/64 (29%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Frame = +3 Query: 294 VLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVR-PKDI 470 VL + +KI + + + + +DS+ V++I+ +++EF IP DAE ++ PK I Sbjct: 7 VLSIVNKIARKNVELGDELLKKNLIDSITTVDLILELQEEFDCYIPATDAESILETPKSI 66 Query: 471 VQYI 482 + Y+ Sbjct: 67 INYL 70 >UniRef50_Q4A6Y8 Cluster: Putative acyl carrier protein; n=1; Mycoplasma synoviae 53|Rep: Putative acyl carrier protein - Mycoplasma synoviae (strain 53) Length = 75 Score = 38.7 bits (86), Expect = 0.13 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 K+ ++ +DS ++DL LDSLD E+I+ E +F EI D + L + DIV I Sbjct: 13 KLTKKEFHLDS-LLSDLKLDSLDIAELIIEAEKKFKIEISDEMLQNLKKVSDIVNLI 68 >UniRef50_Q30R71 Cluster: Phospholipid/glycerol acyltransferase; n=1; Thiomicrospira denitrificans ATCC 33889|Rep: Phospholipid/glycerol acyltransferase - Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1351) Length = 402 Score = 38.7 bits (86), Expect = 0.13 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = +3 Query: 267 DLIKSRVLLVLQLY-DKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 D I + VL+ Y I ++ SH DLGLDSL++VE+ + +E FG +I + Sbjct: 99 DDIDDEIYKVLREYISTITKNKIYPSSHLELDLGLDSLNYVELFVFIEQSFGVKIDEAIF 158 Query: 444 ERLVRPKDIVQYI 482 ++ + + YI Sbjct: 159 SNIMSMRLLHAYI 171 >UniRef50_A4F5C1 Cluster: AuaB protein; n=1; Stigmatella aurantiaca|Rep: AuaB protein - Stigmatella aurantiaca Length = 84 Score = 38.7 bits (86), Expect = 0.13 Identities = 20/75 (26%), Positives = 39/75 (52%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 +T D I+S+V+ + ++ PE L D H +++LG S+ +E I+ +E F F+ Sbjct: 1 MTRDEIRSKVMQIAAEIFELEPEALLGDKHIVDELGATSVLRLEFIVMLERGFKFQFNPE 60 Query: 438 DAERLVRPKDIVQYI 482 + E ++V + Sbjct: 61 EIEVAQNLNEVVDVV 75 >UniRef50_P15543 Cluster: Acyl carrier protein 3, chloroplast precursor; n=1; Hordeum vulgare|Rep: Acyl carrier protein 3, chloroplast precursor - Hordeum vulgare (Barley) Length = 132 Score = 38.7 bits (86), Expect = 0.13 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +3 Query: 354 NDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +DLG DSLD VE++M +E+EF + + A+ + +D I Sbjct: 81 SDLGADSLDTVEIVMGLEEEFQISVEETSAQAIATVEDAATLI 123 >UniRef50_Q3AHI1 Cluster: Possible acyl carrier protein; n=4; Synechococcus|Rep: Possible acyl carrier protein - Synechococcus sp. (strain CC9605) Length = 94 Score = 38.3 bits (85), Expect = 0.17 Identities = 18/71 (25%), Positives = 36/71 (50%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 ++ R++ +L +P +T D+ M D+G+DSL E+++ + FG I + + Sbjct: 12 LEGRLVEILHRISGADPAAITPDARLMEDIGIDSLGFYEILIEADTCFGIRIQEEQLLQF 71 Query: 453 VRPKDIVQYIA 485 DI ++A Sbjct: 72 KTVGDIQNHLA 82 >UniRef50_Q3D8G2 Cluster: Acyl carrier protein; n=8; Streptococcus agalactiae|Rep: Acyl carrier protein - Streptococcus agalactiae COH1 Length = 79 Score = 38.3 bits (85), Expect = 0.17 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +T +S +DL +DS+ E I+ +ED F EIPD E + + ++ YI Sbjct: 25 ITPESSLHDDLAIDSIALTEFIINLEDVFHLEIPDEAVEHMSSVQQLLDYI 75 >UniRef50_Q21RA5 Cluster: Putative uncharacterized protein; n=1; Rhodoferax ferrireducens T118|Rep: Putative uncharacterized protein - Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118) Length = 145 Score = 38.3 bits (85), Expect = 0.17 Identities = 16/40 (40%), Positives = 27/40 (67%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 ++P+Q + DL LDSL +E++ +ED++GF+IPD Sbjct: 75 VDPQQFENPELKIADLELDSLGLIEMLFEVEDKYGFQIPD 114 >UniRef50_A7GPR0 Cluster: Phosphopantetheine-binding; n=1; Bacillus cereus subsp. cytotoxis NVH 391-98|Rep: Phosphopantetheine-binding - Bacillus cereus subsp. cytotoxis NVH 391-98 Length = 81 Score = 38.3 bits (85), Expect = 0.17 Identities = 21/75 (28%), Positives = 42/75 (56%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 ++LD+I+ + +++ K L D F N LG++S+D + +++ +E +FG E + Sbjct: 1 MSLDVIEV-LRNIIETESKKEISSLKEDMTFTN-LGIESMDKIRIVIQVERKFGVEFSET 58 Query: 438 DAERLVRPKDIVQYI 482 DA + D+V +I Sbjct: 59 DAANIETIGDLVHFI 73 >UniRef50_A0W4S9 Cluster: Beta-ketoacyl synthase; n=2; Proteobacteria|Rep: Beta-ketoacyl synthase - Geobacter lovleyi SZ Length = 2547 Score = 38.3 bits (85), Expect = 0.17 Identities = 23/57 (40%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYD-KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 +DL+K V VL++ KI+P +L ++D+GLDSL VE+ +A+E FG ++P Sbjct: 2421 MDLLKHEVGTVLRIDPTKIDPNRL------LSDMGLDSLMGVELAVALESLFGIKVP 2471 >UniRef50_Q11Y41 Cluster: Acyl carrier protein; n=1; Cytophaga hutchinsonii ATCC 33406|Rep: Acyl carrier protein - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) Length = 87 Score = 37.9 bits (84), Expect = 0.22 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 3/73 (4%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMND-LGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 +K +++ L L + PE + D + LGLDS+D +E+I+ ++ E+G +I D R Sbjct: 10 LKEQIIKFLNLIS-VTPEDIKDDEPLFGEGLGLDSIDSLELIVLLDREYGIKITDPKDGR 68 Query: 450 --LVRPKDIVQYI 482 LV +V YI Sbjct: 69 KVLVDINTMVAYI 81 >UniRef50_A0W3S1 Cluster: Phosphopantetheine-binding; n=1; Geobacter lovleyi SZ|Rep: Phosphopantetheine-binding - Geobacter lovleyi SZ Length = 88 Score = 37.9 bits (84), Expect = 0.22 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +3 Query: 345 HFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 H DLG+DS+ V++++A+ED I D D RL D V + Sbjct: 30 HLQRDLGIDSIRFVQLVLALEDRLTIAIDDADLFRLRSVGDCVDLV 75 >UniRef50_Q98QK3 Cluster: Acyl carrier protein homolog; n=1; Mycoplasma pulmonis|Rep: Acyl carrier protein homolog - Mycoplasma pulmonis Length = 73 Score = 37.9 bits (84), Expect = 0.22 Identities = 21/64 (32%), Positives = 37/64 (57%) Frame = +3 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 ++ QL K+ ++T +S F +++G+DSLD VE + +E F EI D + + + DI Sbjct: 7 IITQL-SKLTKNKITEESLF-SEIGIDSLDLVEHVSDLEQHFDIEISDEELLNIKKVNDI 64 Query: 471 VQYI 482 + I Sbjct: 65 IVLI 68 >UniRef50_A7DJ46 Cluster: Phosphopantetheine-binding; n=3; Methylobacterium|Rep: Phosphopantetheine-binding - Methylobacterium extorquens PA1 Length = 179 Score = 37.5 bits (83), Expect = 0.29 Identities = 13/36 (36%), Positives = 27/36 (75%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 +++T +SH ++DLG+DSL +++ A++ FG ++P Sbjct: 105 DKITPESHAIDDLGIDSLAFLDIAFAVDKAFGIKLP 140 >UniRef50_A1UBW6 Cluster: Phosphopantetheine-binding protein; n=3; Mycobacterium|Rep: Phosphopantetheine-binding protein - Mycobacterium sp. (strain KMS) Length = 86 Score = 37.5 bits (83), Expect = 0.29 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +3 Query: 273 IKSRVLLVL-QLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 I+ V+ VL ++ ++ +QL + + LDS+D + ++ + +F EIP+ D + Sbjct: 8 IRDDVVAVLTRIAPEVEADQLEENEPLREQVDLDSMDWLNFLVGVHKQFDVEIPESDYAK 67 Query: 450 LVRPKDIVQYI 482 L IV+YI Sbjct: 68 LRTVASIVRYI 78 >UniRef50_Q2TXJ8 Cluster: Polyketide synthase modules and related proteins; n=2; Aspergillus|Rep: Polyketide synthase modules and related proteins - Aspergillus oryzae Length = 2580 Score = 37.5 bits (83), Expect = 0.29 Identities = 24/80 (30%), Positives = 42/80 (52%) Frame = +3 Query: 243 SGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGF 422 S GP ++L +R+ V+ + I+P ++T D + M D G+DSL +E+ ME+ F Sbjct: 1645 SSGPKSRINLT-ARIKEVVAEFCAIDPSEITEDGN-MADAGVDSLMAMELAREMEEAFHC 1702 Query: 423 EIPDGDAERLVRPKDIVQYI 482 +P D +D+V + Sbjct: 1703 TLPAADLMEADTFRDLVNCV 1722 >UniRef50_P23235 Cluster: Acyl carrier protein 2, chloroplast precursor; n=1; Spinacia oleracea|Rep: Acyl carrier protein 2, chloroplast precursor - Spinacia oleracea (Spinach) Length = 130 Score = 37.5 bits (83), Expect = 0.29 Identities = 16/52 (30%), Positives = 34/52 (65%) Frame = +3 Query: 327 QLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++T ++ F +++G DSLD VE++M +E+EFG + + +A+ + ++ I Sbjct: 73 KVTGETKF-SEIGADSLDTVEIVMKLEEEFGVTVEEENAQTITTIQEAADMI 123 >UniRef50_Q47GV2 Cluster: Phosphopantetheine-binding; n=1; Dechloromonas aromatica RCB|Rep: Phosphopantetheine-binding - Dechloromonas aromatica (strain RCB) Length = 79 Score = 37.1 bits (82), Expect = 0.39 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 I PE L D+ + D GLDSL E++ A+E+ F + PD A+ Sbjct: 17 IEPETLKADAP-LADYGLDSLSLAELLFAIEEHFNLDFPDDRAD 59 >UniRef50_Q2YC16 Cluster: Phosphopantetheine-binding; n=1; Nitrosospira multiformis ATCC 25196|Rep: Phosphopantetheine-binding - Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) Length = 91 Score = 37.1 bits (82), Expect = 0.39 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +3 Query: 273 IKSRVL-LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 I+++V+ + + ++ + S F +LGLDS+D ++++ ED FG +A+ Sbjct: 12 IEAKVIQFIATKVENLDASTINRSSKF-EELGLDSMDTIQLLFDAEDAFGINFDSEEAKG 70 Query: 450 LVRPKDIVQYI 482 DIV YI Sbjct: 71 FTTVGDIVSYI 81 >UniRef50_Q1R718 Cluster: Acyl carrier protein, putative; n=7; Enterobacteriaceae|Rep: Acyl carrier protein, putative - Escherichia coli (strain UTI89 / UPEC) Length = 82 Score = 37.1 bits (82), Expect = 0.39 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +3 Query: 318 NPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 N ++ DS +NDLGL+S+ ++++M +ED F IP Sbjct: 21 NGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIP 58 >UniRef50_Q1N371 Cluster: Putative acyl carrier protein; n=1; Oceanobacter sp. RED65|Rep: Putative acyl carrier protein - Oceanobacter sp. RED65 Length = 98 Score = 37.1 bits (82), Expect = 0.39 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSH-FMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 LD +K ++ L LY + P+ + D+ F + L LDS+D EV++ ++ FG ++P+G Sbjct: 16 LDEVKRVLIERLNLYQE--PQDIDEDTPLFGSGLRLDSVDATEVVVMLDMSFGIKVPEGT 73 Query: 441 AERLVR 458 +R Sbjct: 74 DPSFMR 79 >UniRef50_A5LD73 Cluster: Putative uncharacterized protein; n=1; Streptococcus pneumoniae SP3-BS71|Rep: Putative uncharacterized protein - Streptococcus pneumoniae SP3-BS71 Length = 79 Score = 37.1 bits (82), Expect = 0.39 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +3 Query: 351 MNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 + D G+DSL ++ +I+A+ED F EIPD Sbjct: 30 LTDYGVDSLKYISIILALEDYFKIEIPD 57 >UniRef50_Q6F0M2 Cluster: Acyl carrier protein I precurser; n=3; Mollicutes|Rep: Acyl carrier protein I precurser - Mesoplasma florum (Acholeplasma florum) Length = 74 Score = 36.7 bits (81), Expect = 0.51 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +3 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 ++ +L K LT ++ F + +GLDSLD +++I +ED +PD + KD+ Sbjct: 7 IIKELKSKGAKGNLTAETQF-SSIGLDSLDLMDMITVLEDRLSIFVPDDKLLEIKTIKDL 65 Query: 471 VQYIA 485 IA Sbjct: 66 ENVIA 70 >UniRef50_Q2YCD0 Cluster: Acyl carrier protein, ACP; n=1; Nitrosospira multiformis ATCC 25196|Rep: Acyl carrier protein, ACP - Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) Length = 78 Score = 36.7 bits (81), Expect = 0.51 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 I++R V+ +I P+ ++ D N DSL H+ +I+A+E+EFG E D Sbjct: 4 IENRTRDVMAKVLQIAPQDISPDISRKNLPAWDSLKHMNLILALEEEFGIEFSD 57 >UniRef50_A6Q8W7 Cluster: Acyl carrier protein ACP; n=1; Sulfurovum sp. NBC37-1|Rep: Acyl carrier protein ACP - Sulfurovum sp. (strain NBC37-1) Length = 82 Score = 36.7 bits (81), Expect = 0.51 Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +3 Query: 258 LTLDLIKSRVLL-VLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 +T D IK +++ + ++ + E + + + L +DS D + ++ A+ DE G E+P+ Sbjct: 1 MTKDEIKKKIIEEIYEIAPEHEGETIPENENIQRSLEIDSFDFLNLLTALNDELGVEVPE 60 Query: 435 GD 440 D Sbjct: 61 SD 62 >UniRef50_A4L2R3 Cluster: AcpP; n=6; Lactobacillus|Rep: AcpP - Lactobacillus reuteri Length = 80 Score = 36.7 bits (81), Expect = 0.51 Identities = 18/56 (32%), Positives = 34/56 (60%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++ ++T+D+ +DL DSLD E++ +ED+F E+ D D E + D+V ++ Sbjct: 20 VDENRVTMDARIKDDLDADSLDVFEIMNELEDKFEIEL-DAD-EGIETISDVVDFV 73 >UniRef50_A4FL00 Cluster: Probable acyl carrier protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Probable acyl carrier protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 79 Score = 36.7 bits (81), Expect = 0.51 Identities = 23/70 (32%), Positives = 38/70 (54%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 +D + SRV +L ++ L D+ F +D+GLDSL VE+ + EFG +I D + Sbjct: 1 MDDLFSRVSELLASRFEVEQADLRSDASF-DDMGLDSLAQVELGEILAQEFGVDIDDEEM 59 Query: 444 ERLVRPKDIV 473 E + ++V Sbjct: 60 ENMSTLTELV 69 >UniRef50_A0BRK8 Cluster: Chromosome undetermined scaffold_123, whole genome shotgun sequence; n=5; Oligohymenophorea|Rep: Chromosome undetermined scaffold_123, whole genome shotgun sequence - Paramecium tetraurelia Length = 144 Score = 36.7 bits (81), Expect = 0.51 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = +3 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 LV Y N L++DS + GLDSLD +E+ M +E++ G+ I L + + Sbjct: 66 LVKNYYRTTNKSALSLDSE-LEQHGLDSLDSIELSMQIEEDLGYVISAETLPVLNKLRHY 124 Query: 471 VQYI 482 V YI Sbjct: 125 VNYI 128 >UniRef50_Q6KI70 Cluster: Acyl carrier protein; n=1; Mycoplasma mobile|Rep: Acyl carrier protein - Mycoplasma mobile Length = 79 Score = 36.3 bits (80), Expect = 0.67 Identities = 17/61 (27%), Positives = 35/61 (57%) Frame = +3 Query: 291 LVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDI 470 ++ Q N DS ++++G+DSLD VE+I+ E++F ++ D + +L K++ Sbjct: 11 IIFQALKSKNASSFVEDSK-ISEIGIDSLDLVELIIENEEKFLVQVSDDELTKLKSVKEV 69 Query: 471 V 473 + Sbjct: 70 I 70 >UniRef50_Q5QXD4 Cluster: Acyl carrier protein; n=4; Proteobacteria|Rep: Acyl carrier protein - Idiomarina loihiensis Length = 83 Score = 36.3 bits (80), Expect = 0.67 Identities = 21/75 (28%), Positives = 46/75 (61%), Gaps = 1/75 (1%) Frame = +3 Query: 261 TLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 T D + +R+ +L+ +I+ +++D++ DL LDS+D V++++ + + G +I D Sbjct: 3 TRDEVYARLTQILEEDFEIDSGDISLDANLYQDLDLDSIDAVDLVVKLREITGKKI-SPD 61 Query: 441 AERLVRP-KDIVQYI 482 A + VR +D+V+ + Sbjct: 62 AFKAVRTVEDVVEEV 76 >UniRef50_Q5KZX7 Cluster: Acyl carrier protein; n=1; Geobacillus kaustophilus|Rep: Acyl carrier protein - Geobacillus kaustophilus Length = 64 Score = 36.3 bits (80), Expect = 0.67 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEI 428 EQ+T +S F NDLG+DSL V +++ + ++ EI Sbjct: 4 EQVTAESSFQNDLGVDSLQLVHLLVVLAEKLQLEI 38 >UniRef50_Q3F0M5 Cluster: Acyl carrier protein; n=2; Bacteria|Rep: Acyl carrier protein - Bacillus thuringiensis serovar israelensis ATCC 35646 Length = 98 Score = 36.3 bits (80), Expect = 0.67 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +3 Query: 312 KINPEQLTVDSH-FMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +I P +T D F LG+DSLD +E+ +A+E+EFG + D + L I +I Sbjct: 32 EIEPHFITDDQPLFGRGLGVDSLDALELFLAIEEEFGVAVYDENMAVLGSINKIADFI 89 >UniRef50_Q08QZ9 Cluster: Coronafacic acid synthetase, acyl carrier protein component; n=1; Stigmatella aurantiaca DW4/3-1|Rep: Coronafacic acid synthetase, acyl carrier protein component - Stigmatella aurantiaca DW4/3-1 Length = 90 Score = 36.3 bits (80), Expect = 0.67 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +3 Query: 288 LLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 +L L+ +I EQ+ D + +GLDS+ +E+ + ED+FG I D D Sbjct: 12 ILTTNLFVEIPEEQIGGDDGLQSVVGLDSVGFLELRVICEDQFGVSISDED 62 >UniRef50_A4CL45 Cluster: Acyl carrier protein; n=4; Flavobacteriaceae|Rep: Acyl carrier protein - Robiginitalea biformata HTCC2501 Length = 84 Score = 36.3 bits (80), Expect = 0.67 Identities = 15/60 (25%), Positives = 32/60 (53%) Frame = +3 Query: 303 LYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 L + ++P+ + DS + DL ++S V++++ +ED F + D D + + D + I Sbjct: 18 LPEDVDPDTVGPDSRLVADLNINSAHLVDIVLDVEDRFDIRLEDADMQEMATVADALGVI 77 >UniRef50_A1ASP7 Cluster: Phosphopantetheine-binding; n=1; Pelobacter propionicus DSM 2379|Rep: Phosphopantetheine-binding - Pelobacter propionicus (strain DSM 2379) Length = 85 Score = 36.3 bits (80), Expect = 0.67 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +3 Query: 318 NPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIV 473 +P + ++ +NDL LDSL +E++ +ED F F P + + KD V Sbjct: 25 SPVTIGEETELVNDLQLDSLKVMEIVEEVEDSFDFSFPLNELSGIRTVKDFV 76 >UniRef50_A0JS86 Cluster: Phosphopantetheine-binding; n=1; Arthrobacter sp. FB24|Rep: Phosphopantetheine-binding - Arthrobacter sp. (strain FB24) Length = 80 Score = 36.3 bits (80), Expect = 0.67 Identities = 17/64 (26%), Positives = 34/64 (53%) Frame = +3 Query: 294 VLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIV 473 + Q+ ++ + L S DL LDSLD + ++ ++ + G +IP+ D + K ++ Sbjct: 14 ISQVAPDVDFDGLDEGSRLRQDLELDSLDFLRLVESINEATGVDIPERDYTAVATVKGMI 73 Query: 474 QYIA 485 Y+A Sbjct: 74 DYLA 77 >UniRef50_Q7NBP1 Cluster: AcpP; n=1; Mycoplasma gallisepticum|Rep: AcpP - Mycoplasma gallisepticum Length = 86 Score = 35.9 bits (79), Expect = 0.89 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 357 DLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 +LG+DSLD ++I+ +E EF E D ++ D++ YI Sbjct: 40 ELGIDSLDLFDIIVELESEFNIEFSDEKLMKIKTINDLILYI 81 >UniRef50_Q38XG3 Cluster: Acyl carrier protein; n=1; Lactobacillus sakei subsp. sakei 23K|Rep: Acyl carrier protein - Lactobacillus sakei subsp. sakei (strain 23K) Length = 79 Score = 35.9 bits (79), Expect = 0.89 Identities = 22/72 (30%), Positives = 40/72 (55%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 D++K ++ + D + Q+T ++ DL DSLD EV+ +ED+ ++ D D E Sbjct: 5 DILKKVQAVIAEQLD-VEESQVTPTTNIREDLDADSLDIFEVMNQLEDDMELKL-DPD-E 61 Query: 447 RLVRPKDIVQYI 482 +V +++V YI Sbjct: 62 SIVTVQNVVDYI 73 >UniRef50_Q2RYE6 Cluster: Acyl carrier protein; n=2; Alphaproteobacteria|Rep: Acyl carrier protein - Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) Length = 83 Score = 35.9 bits (79), Expect = 0.89 Identities = 16/53 (30%), Positives = 35/53 (66%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 ++S++ ++ I+ +LT ++ +++L + SLD VE++ A+E+EF E+P Sbjct: 4 VESKIYDIIVEKTNIDRAKLTREAS-LSELEISSLDFVEIVFAVEEEFDIEVP 55 >UniRef50_Q6DNE0 Cluster: CurM; n=1; Lyngbya majuscula|Rep: CurM - Lyngbya majuscula Length = 2147 Score = 35.9 bits (79), Expect = 0.89 Identities = 18/54 (33%), Positives = 34/54 (62%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEI 428 D++K+ + LV+ INP +++ D +F+ +LG+DSL +EV+ + + F I Sbjct: 1514 DILKNYIQLVVAKTLGINPSKISTDDNFV-ELGMDSLMGMEVVNKLSGDLDFII 1566 >UniRef50_Q2MGC9 Cluster: ACP; n=1; Streptomyces griseus|Rep: ACP - Streptomyces griseus Length = 84 Score = 35.9 bits (79), Expect = 0.89 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +3 Query: 357 DLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 ++G DSL +E+ ++ E+G +IPD E + P+ ++ Y+ Sbjct: 36 EIGYDSLAVLEIASQLQREYGLQIPDEAIEEMDTPQAVIDYV 77 >UniRef50_A6KZ42 Cluster: Putative uncharacterized protein; n=1; Bacteroides vulgatus ATCC 8482|Rep: Putative uncharacterized protein - Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) Length = 83 Score = 35.9 bits (79), Expect = 0.89 Identities = 19/61 (31%), Positives = 34/61 (55%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 +T + I ++ L +I+ EQ+ D+ M L LDSLD V++++ ++ FGF + Sbjct: 1 MTNEEIIEKIRTTLAEEFEIDVEQIQPDAPLMQTLELDSLDLVDMVVLIDKNFGFTVTAK 60 Query: 438 D 440 D Sbjct: 61 D 61 >UniRef50_A5NTM2 Cluster: AMP-dependent synthetase and ligase; n=1; Methylobacterium sp. 4-46|Rep: AMP-dependent synthetase and ligase - Methylobacterium sp. 4-46 Length = 958 Score = 35.9 bits (79), Expect = 0.89 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 1/92 (1%) Frame = +3 Query: 201 ALQNGNEKHGIRKYSGGPPLTLDLIKSRVLLVLQLY-DKINPEQLTVDSHFMNDLGLDSL 377 ALQN + G P D+++ L+L+L+ ++ + +DS DLGLDSL Sbjct: 10 ALQNVTPQAGDPAERHREPTAADVLEVIRSLLLELHPERRRSPAVDLDSDLERDLGLDSL 69 Query: 378 DHVEVIMAMEDEFGFEIPDGDAERLVRPKDIV 473 E+++ + F +P+ P D++ Sbjct: 70 GRAELLLRLSRRFRILLPERLIGEASTPDDLL 101 >UniRef50_A5IZH4 Cluster: Acyl carrier protein homolog; n=1; Mycoplasma agalactiae|Rep: Acyl carrier protein homolog - Mycoplasma agalactiae Length = 77 Score = 35.9 bits (79), Expect = 0.89 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQ 476 KINPE +L +DSL E++ +E+++ IPD D + + + KDI Q Sbjct: 22 KINPEST------FQELKIDSLSLAELVFDLEEKYNVMIPDDDLKNIKKVKDIEQ 70 >UniRef50_A5GEF3 Cluster: Putative uncharacterized protein; n=1; Geobacter uraniumreducens Rf4|Rep: Putative uncharacterized protein - Geobacter uraniumreducens Rf4 Length = 81 Score = 35.9 bits (79), Expect = 0.89 Identities = 14/56 (25%), Positives = 32/56 (57%) Frame = +3 Query: 318 NPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 +P L+ + + L +DS D ++ ++A+++ G EIP+ D E + ++ Y++ Sbjct: 22 DPASLSPEENIREALDIDSYDFLQFLIAIDEAIGVEIPEADYEDVFTMGGLLNYLS 77 >UniRef50_A4E9I2 Cluster: Putative uncharacterized protein; n=1; Collinsella aerofaciens ATCC 25986|Rep: Putative uncharacterized protein - Collinsella aerofaciens ATCC 25986 Length = 78 Score = 35.9 bits (79), Expect = 0.89 Identities = 13/26 (50%), Positives = 22/26 (84%) Frame = +3 Query: 351 MNDLGLDSLDHVEVIMAMEDEFGFEI 428 + ++GLDSL VE+++A+EDEFG ++ Sbjct: 31 LEEIGLDSLGTVEILVAVEDEFGIQL 56 >UniRef50_A3XNJ1 Cluster: Putative uncharacterized protein; n=1; Leeuwenhoekiella blandensis MED217|Rep: Putative uncharacterized protein - Leeuwenhoekiella blandensis MED217 Length = 197 Score = 35.9 bits (79), Expect = 0.89 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +3 Query: 375 LDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 LD VE+IM++ED+FG I D +AE++ ++ + Sbjct: 3 LDSVELIMSVEDKFGIRIEDSEAEKIYTVQEFADIV 38 >UniRef50_Q56035 Cluster: Probable acyl carrier protein iacP; n=4; Salmonella|Rep: Probable acyl carrier protein iacP - Salmonella typhimurium Length = 82 Score = 35.9 bits (79), Expect = 0.89 Identities = 16/70 (22%), Positives = 36/70 (51%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I++RV V+ ++ + + +H + DL DSLD ++++ + +EF + D + Sbjct: 5 IEARVKKVITSCIAVDVDSINGQTHLVEDLYADSLDLIDIVFGLSEEFDISCNENDLPDM 64 Query: 453 VRPKDIVQYI 482 + DI + + Sbjct: 65 MTFADICRVV 74 >UniRef50_P48078 Cluster: Acyl carrier protein; n=1; Cyanophora paradoxa|Rep: Acyl carrier protein - Cyanophora paradoxa Length = 103 Score = 35.9 bits (79), Expect = 0.89 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 I +L +D + DL +DSLD VE+I +E++F +I D Sbjct: 30 IEKTELNLDLYIYEDLKIDSLDLVEIIKQIEEKFDIKIDD 69 >UniRef50_Q9PPY4 Cluster: Acyl carrier protein homolog; n=1; Ureaplasma parvum|Rep: Acyl carrier protein homolog - Ureaplasma parvum (Ureaplasma urealyticum biotype 1) Length = 77 Score = 35.9 bits (79), Expect = 0.89 Identities = 15/53 (28%), Positives = 32/53 (60%) Frame = +3 Query: 315 INPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIV 473 +N + L ++ + LG+DSL + +IM +ED+ G ++PD ++ +D++ Sbjct: 20 LNMDNLNIE---LKSLGIDSLSAMNLIMKIEDQIGVQLPDEKLLKIKNLRDLI 69 >UniRef50_Q83EJ7 Cluster: Acyl carrier protein; n=3; Coxiella burnetii|Rep: Acyl carrier protein - Coxiella burnetii Length = 83 Score = 35.5 bits (78), Expect = 1.2 Identities = 20/70 (28%), Positives = 34/70 (48%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 I R+ ++ +I E + +S F +LG DSLD V +I A+ EF + + D L Sbjct: 5 INHRIKTIIAAQSQIPIENIHDNSKFHANLGFDSLDVVNLISAINMEFSLNLMENDIIHL 64 Query: 453 VRPKDIVQYI 482 ++V + Sbjct: 65 ETVAELVDCV 74 >UniRef50_Q47ZG8 Cluster: Polyunsaturated fatty acid synthase PfaA; n=1; Colwellia psychrerythraea 34H|Rep: Polyunsaturated fatty acid synthase PfaA - Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibriopsychroerythus) Length = 2771 Score = 35.5 bits (78), Expect = 1.2 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 3/85 (3%) Frame = +3 Query: 237 KYSGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEF 416 K S P + LD I+S ++ V+ E L + DLG+DS+ VE++ A+++ Sbjct: 1652 KVSSAPAIDLDYIQSVMMTVVAEKTGYPTEMLELAMDMEADLGIDSIKRVEILGAVQETI 1711 Query: 417 GFEIPDGDAERLVRPK---DIVQYI 482 ++P+ + E L + +IV Y+ Sbjct: 1712 P-DLPELNPEDLAELRTLGEIVSYM 1735 Score = 34.3 bits (75), Expect = 2.7 Identities = 22/83 (26%), Positives = 44/83 (53%), Gaps = 3/83 (3%) Frame = +3 Query: 243 SGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGF 422 + P + LD I+S ++ V+ E L ++ DLG+DS+ VE++ A+++ Sbjct: 1546 ASAPAIDLDYIQSVMMTVVAEKTGYPTEMLELEMDMEADLGIDSIKRVEILGAVQETIP- 1604 Query: 423 EIPDGDAERLVRPK---DIVQYI 482 ++P+ + E L + +IV Y+ Sbjct: 1605 DLPELNPEDLAELRTLGEIVSYM 1627 >UniRef50_Q9L4X3 Cluster: NysI; n=4; root|Rep: NysI - Streptomyces noursei Length = 9477 Score = 35.5 bits (78), Expect = 1.2 Identities = 23/77 (29%), Positives = 36/77 (46%) Frame = +3 Query: 252 PPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 P LDL++++V VL D E D H DLG DSL +E+ A+ G +P Sbjct: 6345 PAAVLDLLRTQVAAVLGHADPRTVE----DDHAFRDLGFDSLTILELRNALNAATGLSLP 6400 Query: 432 DGDAERLVRPKDIVQYI 482 L P+++ ++ Sbjct: 6401 ATLVYDLPTPREMADFL 6417 >UniRef50_Q1IMP1 Cluster: AMP-dependent synthetase and ligase; n=1; Acidobacteria bacterium Ellin345|Rep: AMP-dependent synthetase and ligase - Acidobacteria bacterium (strain Ellin345) Length = 918 Score = 35.5 bits (78), Expect = 1.2 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +3 Query: 357 DLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 DLGLDS++ VE+++ +E G ++PD + + +++V + Sbjct: 619 DLGLDSMERVEMLVEIEQALGADVPDSVSGEIYSVRELVDAV 660 >UniRef50_Q0G361 Cluster: Putative uncharacterized protein; n=3; Aurantimonadaceae|Rep: Putative uncharacterized protein - Fulvimarina pelagi HTCC2506 Length = 433 Score = 35.5 bits (78), Expect = 1.2 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +3 Query: 318 NPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG--DAERLVRPKDIV 473 N E+ + + DLG+DS+ +E+ + +E GFE+P D RL+ D++ Sbjct: 25 NMERFAIAARLREDLGIDSVVLMELFVRLETGHGFEVPKTALDGARLITVGDLI 78 >UniRef50_A5W7D5 Cluster: Beta-ketoacyl synthase-like protein precursor; n=2; Bacteria|Rep: Beta-ketoacyl synthase-like protein precursor - Pseudomonas putida F1 Length = 2499 Score = 35.5 bits (78), Expect = 1.2 Identities = 19/56 (33%), Positives = 34/56 (60%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 +D++K V +L+L P +L + ++GLDSL VE+++A+E+ FG +P Sbjct: 2381 VDMLKHEVCEILRL----PPARLDAQRP-LQEMGLDSLMSVELVVALEERFGIRLP 2431 >UniRef50_A4X8N7 Cluster: Phosphopantetheine-binding; n=1; Salinispora tropica CNB-440|Rep: Phosphopantetheine-binding - Salinispora tropica CNB-440 Length = 84 Score = 35.5 bits (78), Expect = 1.2 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 ++ PE+LT F+ D DSL +E++ ++ +F EIP + +L Sbjct: 20 ELEPEELTETGDFVADYEADSLRAIEILARIDKKFKIEIPQSELPQL 66 >UniRef50_A0NLC3 Cluster: D-alanyl carrier protein; n=4; Lactobacillales|Rep: D-alanyl carrier protein - Oenococcus oeni ATCC BAA-1163 Length = 77 Score = 35.5 bits (78), Expect = 1.2 Identities = 18/55 (32%), Positives = 36/55 (65%), Gaps = 3/55 (5%) Frame = +3 Query: 294 VLQLYDKINPEQLTV---DSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 VL + + I+ E L+ D++F N L +DS+ V++++A++D+FG +P + +R Sbjct: 5 VLAILENISGEDLSNQMDDNYFDNGL-MDSMATVDLVLALQDKFGINVPVSEFDR 58 >UniRef50_A0M1T4 Cluster: Acyl-carrier protein; n=5; Flavobacteriaceae|Rep: Acyl-carrier protein - Gramella forsetii (strain KT0803) Length = 84 Score = 35.5 bits (78), Expect = 1.2 Identities = 15/43 (34%), Positives = 28/43 (65%) Frame = +3 Query: 339 DSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKD 467 ++ F+NDL ++S + V+V++ +EDEF EI + E ++ D Sbjct: 30 ETDFLNDLQINSANLVDVVLDVEDEFNIEIDNDSMEGMLTVGD 72 >UniRef50_A6XGU0 Cluster: Acyl carrier protein, isoform 1; n=1; Polytomella parva|Rep: Acyl carrier protein, isoform 1 - Polytomella parva Length = 127 Score = 35.5 bits (78), Expect = 1.2 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 324 EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEI-PDGDAERLVRPKDIVQYI 482 E++ +S F DLG DSLD VE++MA+E++F + + AE++ ++ I Sbjct: 68 EKVAPESKFA-DLGADSLDTVEIMMALEEKFQITLSEEAGAEKITTVQEAADLI 120 >UniRef50_Q8GGP0 Cluster: Acyl carrier protein type II; n=1; Streptomyces atroolivaceus|Rep: Acyl carrier protein type II - Streptomyces atroolivaceus Length = 86 Score = 35.1 bits (77), Expect = 1.6 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINP---EQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 LD+ LV+++ +I P QL + DLG DS+D VE+I A+ D + P Sbjct: 6 LDVRAQTARLVVEVVTEILPGVDPQLIGGKRHLKDLGADSVDRVEIIAALLDRTRVDAPM 65 Query: 435 GDAERLVRPKDIVQYIA 485 D L ++ +++ Sbjct: 66 SDFSDLPDIDSLIDFLS 82 >UniRef50_Q12FH1 Cluster: Phosphopantetheine-binding; n=7; Bacteria|Rep: Phosphopantetheine-binding - Polaromonas sp. (strain JS666 / ATCC BAA-500) Length = 87 Score = 35.1 bits (77), Expect = 1.6 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 2/70 (2%) Frame = +3 Query: 279 SRVLL--VLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERL 452 SR++L + + ++ P + D + + LDS+D + ++A+ + FG I + D +L Sbjct: 9 SRIVLDILCSIAPEVVPATIEPDRPLRHQVDLDSMDWLNFLVALHERFGVTIAEADYAQL 68 Query: 453 VRPKDIVQYI 482 V +++ Y+ Sbjct: 69 VTLGNVLDYL 78 >UniRef50_Q11T85 Cluster: Acyl carrier protein; n=10; Bacteria|Rep: Acyl carrier protein - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) Length = 94 Score = 35.1 bits (77), Expect = 1.6 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSH-FMNDLGLDSLDHVEVIMAMEDEFGFEI 428 +K ++ L L D I PE + ++ F++ LGLDS+D +E+I+ ++ ++G ++ Sbjct: 8 LKKEIISQLNLQD-ITPEDIKDNAPLFVDGLGLDSIDVLELIVLLQKKYGIKV 59 >UniRef50_A6PSD7 Cluster: Putative uncharacterized protein; n=1; Victivallis vadensis ATCC BAA-548|Rep: Putative uncharacterized protein - Victivallis vadensis ATCC BAA-548 Length = 411 Score = 35.1 bits (77), Expect = 1.6 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = +3 Query: 366 LDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPK--DIVQYI 482 LDSL+ E I+ ME++F I D +AE L+ +IV+Y+ Sbjct: 360 LDSLESAEFILGMEEKFHIRITDAEAENLLSGSFAEIVEYV 400 >UniRef50_A6PQQ2 Cluster: Acyl-carrier protein-like protein; n=1; Victivallis vadensis ATCC BAA-548|Rep: Acyl-carrier protein-like protein - Victivallis vadensis ATCC BAA-548 Length = 89 Score = 35.1 bits (77), Expect = 1.6 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSH-FMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAER 449 K ++ LQL +K PE++ D F + LGLDSLD VE+++ ++ ++ D D +R Sbjct: 13 KKNLIEWLQLEEKA-PEEIKDDEPLFGSGLGLDSLDAVEIVIMLQRKYNIPQRDVDQKR 70 >UniRef50_A5UXC0 Cluster: Beta-ketoacyl synthase; n=2; Roseiflexus|Rep: Beta-ketoacyl synthase - Roseiflexus sp. RS-1 Length = 3243 Score = 35.1 bits (77), Expect = 1.6 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +3 Query: 243 SGGPPLTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGF 422 + P D + ++VL V+ PE L +D DLG+D++ E A+ + FG Sbjct: 1955 AAAPAPAADPVAAKVLAVVAEKTGYPPEMLDLDLDLEADLGVDTVKQAETFAAIREAFGI 2014 Query: 423 E 425 E Sbjct: 2015 E 2015 Score = 34.7 bits (76), Expect = 2.1 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFE 425 D + RVL V+ PE L +D DLG+D++ E A+ + FG E Sbjct: 2082 DPVTERVLAVVAEKTGYPPEMLDLDLDLEADLGVDTVKQAETFAAIREAFGIE 2134 Score = 34.3 bits (75), Expect = 2.7 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFE 425 +D + ++VL V+ PE L +D DLG+D++ E A+ + FG E Sbjct: 1848 VDPVAAKVLAVVAEKTGYPPEMLDLDLDLEADLGVDTVKQAETFAAIREAFGIE 1901 Score = 33.9 bits (74), Expect = 3.6 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFE 425 D + ++VL V+ PE L +D DLG+D++ E A+ + FG E Sbjct: 2194 DPVTAKVLAVVAEKTGYPPEMLELDLDLEADLGVDTVKQAETFAAIREAFGIE 2246 Score = 33.9 bits (74), Expect = 3.6 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +3 Query: 267 DLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFE 425 D + ++VL V+ PE L +D DLG+D++ E A+ + FG E Sbjct: 2306 DPVTAKVLAVVAEKTGYPPEMLELDLDLEADLGVDTVKQAETFAAIREAFGIE 2358 Score = 32.7 bits (71), Expect = 8.3 Identities = 19/63 (30%), Positives = 33/63 (52%) Frame = +3 Query: 264 LDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDA 443 +D + ++VL ++ PE L +D DLG+D++ E +A+ + FG IP + Sbjct: 1730 MDGVTAKVLQIVAEKTGYPPEMLDLDLDLEADLGVDTVKQAETFVAVREAFG--IPQVEN 1787 Query: 444 ERL 452 RL Sbjct: 1788 LRL 1790 >UniRef50_A3U6K2 Cluster: Acyl carrier protein; n=5; Bacteria|Rep: Acyl carrier protein - Croceibacter atlanticus HTCC2559 Length = 80 Score = 35.1 bits (77), Expect = 1.6 Identities = 21/75 (28%), Positives = 38/75 (50%) Frame = +3 Query: 258 LTLDLIKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDG 437 +T D I +V L + + + +T ++ L LDSLD V++++A+E FG ++ Sbjct: 1 MTKDQIIEKVNYFLIDEFEADEDDITPQANLKTTLELDSLDFVDLVVAVESNFGVKLVGD 60 Query: 438 DAERLVRPKDIVQYI 482 D +V +D I Sbjct: 61 DFTNVVVLQDFYDLI 75 >UniRef50_A0UWW3 Cluster: Putative uncharacterized protein; n=1; Clostridium cellulolyticum H10|Rep: Putative uncharacterized protein - Clostridium cellulolyticum H10 Length = 92 Score = 35.1 bits (77), Expect = 1.6 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 303 LYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP--DGDAERLVRPKDIVQ 476 LY+ + ++T+DS DL LDS+ +I+++E F F + DA+ + ++ Sbjct: 17 LYENLKDMEITLDSDLKEDLFLDSISFYTLIVSLEQAFNFTFSKVNIDADEFKTVRSMIA 76 Query: 477 YI 482 Y+ Sbjct: 77 YM 78 >UniRef50_Q6XI20 Cluster: Similar to Drosophila melanogaster mtacp1; n=1; Drosophila yakuba|Rep: Similar to Drosophila melanogaster mtacp1 - Drosophila yakuba (Fruit fly) Length = 110 Score = 35.1 bits (77), Expect = 1.6 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +1 Query: 346 TS*MIWVLTHWTMLRS*WQWKMNLDLRYRMVMQRDWSDQKTLSNTLLTR 492 TS W WT RS W W+ +LD R +M R + TL +T TR Sbjct: 58 TSSTTWDWIPWTTWRSSWPWRTSLDSRSPTLMPRSCLNLPTLLSTSPTR 106 >UniRef50_UPI000150ABE5 Cluster: ACYL CARRIER PROTEIN ACPA; n=1; Mycobacterium tuberculosis|Rep: ACYL CARRIER PROTEIN ACPA - Mycobacterium tuberculosis Length = 113 Score = 34.7 bits (76), Expect = 2.1 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 +T + ++DLG DSL ++I +EDEF I DA+ + D+ +A Sbjct: 45 ITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVA 96 >UniRef50_Q9K3H3 Cluster: Putative acyl carrier protein; n=1; Streptomyces coelicolor|Rep: Putative acyl carrier protein - Streptomyces coelicolor Length = 85 Score = 34.7 bits (76), Expect = 2.1 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 288 LLVLQLYDKIN-PEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAE 446 LL L +K P + V + L LDSL VE+ + + +E G E+ DG+A+ Sbjct: 14 LLASVLSNKFEVPSEAIVPTATFEQLDLDSLAVVELFVVLTEELGIEVQDGEAD 67 >UniRef50_Q7UV18 Cluster: Similar to acyl carrier protein; n=1; Pirellula sp.|Rep: Similar to acyl carrier protein - Rhodopirellula baltica Length = 229 Score = 34.7 bits (76), Expect = 2.1 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 375 LDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 LD VE++M +ED FG I + + ER++ D+V I Sbjct: 3 LDAVEIVMIVEDHFGISIRNDETERVLTVGDLVALI 38 >UniRef50_Q0LNS7 Cluster: Amino acid adenylation; n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Amino acid adenylation - Herpetosiphon aurantiacus ATCC 23779 Length = 4101 Score = 34.7 bits (76), Expect = 2.1 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 312 KINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIP 431 K+ PEQ++ D+ F+ LGLDSL V+++ +E G +P Sbjct: 2125 KLPPEQISEDASFLA-LGLDSLQAVDLVKQLEQTLGTTLP 2163 >UniRef50_Q0AYW1 Cluster: Acyl carrier protein; n=1; Syntrophomonas wolfei subsp. wolfei str. Goettingen|Rep: Acyl carrier protein - Syntrophomonas wolfei subsp. wolfei (strain Goettingen) Length = 83 Score = 34.7 bits (76), Expect = 2.1 Identities = 20/53 (37%), Positives = 35/53 (66%) Frame = +3 Query: 276 KSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPD 434 K+R +L QL I+ + + +D+ F +++ DS+D VE+IMA+ED + E P+ Sbjct: 7 KARRILAEQL--DIDVDLIKMDTTF-DEIEADSIDIVEMIMALEDIYDVEFPE 56 >UniRef50_Q097P4 Cluster: Acyl-carrier-like protein; n=1; Stigmatella aurantiaca DW4/3-1|Rep: Acyl-carrier-like protein - Stigmatella aurantiaca DW4/3-1 Length = 113 Score = 34.7 bits (76), Expect = 2.1 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 282 RVLLVLQLYDKINPEQLTVDSHFMND-LGLDSLDHVEVIMAMEDEFGFEIPD 434 R ++V +L +I E+LT D+ ++ L LDS+ E+I +E FGFE D Sbjct: 31 RRMIVHELDVRIQEEELTSDTSLIDGRLALDSIVLFELITLIEKRFGFEFSD 82 >UniRef50_A5TWP6 Cluster: Long-chain-fatty-acid--CoA ligase; n=3; Fusobacterium nucleatum|Rep: Long-chain-fatty-acid--CoA ligase - Fusobacterium nucleatum subsp. polymorphum ATCC 10953 Length = 832 Score = 34.7 bits (76), Expect = 2.1 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +3 Query: 273 IKSRVLLVLQLYDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 +K + ++ + D+ + + +DSH DLG DSLD VE + + + FG + + D Sbjct: 534 MKEKFDIINKYIDERYHKTIDLDSHIELDLGFDSLDIVEFMNFLNETFGITLIEQD 589 >UniRef50_A2VMX1 Cluster: Acyl carrier protein acpA; n=7; Mycobacterium tuberculosis complex|Rep: Acyl carrier protein acpA - Mycobacterium tuberculosis C Length = 143 Score = 34.7 bits (76), Expect = 2.1 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +3 Query: 330 LTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYIA 485 +T + ++DLG DSL ++I +EDEF I DA+ + D+ +A Sbjct: 75 ITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVA 126 >UniRef50_A1AP68 Cluster: Phosphopantetheine-binding; n=1; Pelobacter propionicus DSM 2379|Rep: Phosphopantetheine-binding - Pelobacter propionicus (strain DSM 2379) Length = 77 Score = 34.7 bits (76), Expect = 2.1 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +3 Query: 264 LDLIKSRVLLVLQL-YDKINPEQLTVDSHFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGD 440 ++LI+ L+L++ + EQL S + G+DSLD +MA+E +G I D D Sbjct: 1 MELIEELKQLMLEVGVEPAVVEQLD-PSRLLAQQGVDSLDGPAFVMAVERRYGINISDAD 59 Query: 441 AERL 452 A RL Sbjct: 60 ALRL 63 >UniRef50_Q8IIW4 Cluster: Putative uncharacterized protein; n=8; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 3371 Score = 34.7 bits (76), Expect = 2.1 Identities = 15/54 (27%), Positives = 30/54 (55%) Frame = +2 Query: 86 SITEINNV*NVRNMSSFDRCVAAKVQHN*SRCQNIQKSGPSEWERETWYPQVQR 247 ++ +NN+ N+ NM++ + + +QHN + I+ S ET+Y Q+Q+ Sbjct: 539 NMNNMNNINNINNMNNMNNVQSVNIQHNNNNYNLIKAKEQSSDIIETFYDQIQK 592 >UniRef50_UPI00015BC948 Cluster: UPI00015BC948 related cluster; n=1; unknown|Rep: UPI00015BC948 UniRef100 entry - unknown Length = 824 Score = 34.3 bits (75), Expect = 2.7 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +3 Query: 345 HFMNDLGLDSLDHVEVIMAMEDEFGFEIPDGDAERLVRPKDIVQYI 482 H DLGLDSLD VE++ ++ FG +I + + + + + ++ + Sbjct: 550 HIEIDLGLDSLDKVELLSFLDRTFGIQISEKELSKYLSVEQLMNLV 595 >UniRef50_Q93H99 Cluster: Acyl carrier protein; n=1; Streptomyces avermitilis|Rep: Acyl carrier protein - Streptomyces avermitilis Length = 86 Score = 34.3 bits (75), Expect = 2.7 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 357 DLGLDSLDHVEVIMAMEDEFGFEIPDGD-AERLVRPKDIVQYI 482 D+G DS+ VEV + +E E G +PD D A + PK V+ + Sbjct: 36 DMGYDSVAMVEVTLLVERELGIGLPDDDKASKNSTPKQFVELV 78 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,089,749 Number of Sequences: 1657284 Number of extensions: 11679274 Number of successful extensions: 29349 Number of sequences better than 10.0: 303 Number of HSP's better than 10.0 without gapping: 28309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29340 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51652897375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -