Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0655
         (645 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g19520.1 68418.m02325 mechanosensitive ion channel domain-con...    27   8.1  

>At5g19520.1 68418.m02325 mechanosensitive ion channel
           domain-containing protein / MS ion channel
           domain-containing protein contains Pfam profile PF00924:
           Mechanosensitive ion channel
          Length = 742

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 15/56 (26%), Positives = 33/56 (58%), Gaps = 4/56 (7%)
 Frame = -1

Query: 567 SNLRLILLF--KFNSIASYI*KTAQNVYKIISFFLLAHYYN--DQIVDDNLIYLIQ 412
           ++ +L+L+F  +F  +A  I  T +N+++   F  + H Y+  D+ V D ++ L++
Sbjct: 544 ASTKLLLVFSSQFLGLAFMIGSTCKNIFESFMFVFVMHPYDVGDRCVVDGVMLLVE 599


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,481,900
Number of Sequences: 28952
Number of extensions: 168778
Number of successful extensions: 291
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 291
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1334473344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)