BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0653 (667 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 25 0.86 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.86 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 22 6.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 6.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 6.0 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 24.6 bits (51), Expect = 0.86 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 165 SVEKHTV--LNETPIGNTITDFTIYYYPIFVISAIHCRL 55 S E+H L+ TP ++ +Y P V+ I+CRL Sbjct: 177 SKEEHPTCALDLTPTYAVVSSSISFYVPCIVMLGIYCRL 215 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 24.6 bits (51), Expect = 0.86 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 288 NGDSFDLRANFSVC 247 NGD +DL+ N VC Sbjct: 426 NGDQYDLKKNLKVC 439 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 412 CSRCTYCRHDVHSLQKPLQQ 471 C+ CTY HSL+ L++ Sbjct: 47 CANCTYATKYCHSLKLHLRK 66 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 242 LHDNRKSVSLVTFFLSYRALVIAVSLQWKST 150 LH N S+ +F + ++ SLQW ST Sbjct: 470 LH-NSSPFSIYSFLERLNLIFMSSSLQWSST 499 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 6.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 242 LHDNRKSVSLVTFFLSYRALVIAVSLQWKST 150 LH N S+ +F + ++ SLQW ST Sbjct: 508 LH-NSSPFSIYSFLERLNLIFMSSSLQWSST 537 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,840 Number of Sequences: 438 Number of extensions: 3029 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -