BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0651 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 3.5 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 24 3.5 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 4.7 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.2 bits (50), Expect = 3.5 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 8/58 (13%) Frame = -3 Query: 195 QLCNT**NNKLWNHCITL--------YLTKNKLLKSFSCLIIHDLRGVAATRNHIEIM 46 Q+C N +W+HC + LT N+++ S + + R V NH+E M Sbjct: 181 QVCTPNATNTVWSHCQCVLADGVERGILTVNRMIPGPSIQVCENDRVVIDVENHMEGM 238 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.2 bits (50), Expect = 3.5 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 8/58 (13%) Frame = -3 Query: 195 QLCNT**NNKLWNHCITL--------YLTKNKLLKSFSCLIIHDLRGVAATRNHIEIM 46 Q+C N +W+HC + LT N+++ S + + R V NH+E M Sbjct: 181 QVCTPNATNTVWSHCQCVLADGVERGILTVNRMIPGPSIQVCENDRVVIDVENHMEGM 238 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 4.7 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 452 ELRISTFSYTAGVSLT*LCSVFLTSVHIMLLNVK 553 ELR+ T + + L LCS+ + H+ +++ K Sbjct: 122 ELRLRTKAQVIAILLPILCSLSVAITHVTMVDFK 155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,880 Number of Sequences: 2352 Number of extensions: 11426 Number of successful extensions: 63 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -