BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0649 (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.2 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 2.7 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 8.3 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -2 Query: 340 CICITYSMKSVEKLFKIYFIIKVYYHTTFH*TRVHILL 227 C+ IT+++ + L YF + + ++ F VH LL Sbjct: 61 CVSITFNVHLLFLLCSGYFTVHLLFYCPFIIFTVHFLL 98 Score = 23.0 bits (47), Expect = 2.1 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -2 Query: 367 IVGTKRLLLCICITYSMKSVEKLFKIYFIIKVYYHTTFH*TRVHILLPEKTVY 209 I+ T LL +CI Y ++ L IY+ + + H L P K+ + Sbjct: 273 IIFTMHLLFLLCIYYFYCALIILLCIYYFCRAFIIFPTHFYCAFSLYPLKSTF 325 Score = 22.2 bits (45), Expect = 3.6 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -2 Query: 367 IVGTKRLLLCICITYSMKSVEKLFKIYFIIKVYYHTTFH 251 I+ T LL +CI Y + + L IY+ + T H Sbjct: 121 IIFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFIIFTVH 159 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/27 (25%), Positives = 18/27 (66%) Frame = -2 Query: 169 ELIILCGVFAVVFLSLNMWLSVLEYCH 89 ++ I C +F V+ L ++ +L+ + +C+ Sbjct: 131 QIFITCELFFVILLWISFFLNFMLHCN 157 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.0 bits (42), Expect = 8.3 Identities = 6/23 (26%), Positives = 10/23 (43%) Frame = -1 Query: 173 WGINYSLWSFRCSIPFFKYVVKC 105 W +N +W + FF+ C Sbjct: 403 WSVNAGMWMWLSCSSFFQQFFHC 425 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,517 Number of Sequences: 336 Number of extensions: 3243 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -