BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0648 (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.51 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 25 0.89 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 25 0.89 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 24 1.2 AF487333-1|AAL93262.1| 80|Apis mellifera integrin betaPS protein. 23 2.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.8 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 6.3 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 6.3 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 6.3 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.4 bits (53), Expect = 0.51 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -1 Query: 432 SPADRGDNAGPSDRDSDIFRTLPPT---LNPAFSADSEARRD 316 SP+DRG N SDR T PPT ++ A S D ++ RD Sbjct: 1380 SPSDRGRNDDGSDR-----LTSPPTPLSISRAGSRDEDSTRD 1416 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 24.6 bits (51), Expect = 0.89 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 684 LCARPAHKHALTHELLSSRRDSERPSA 604 LC R H+ L +ELLSS ERP A Sbjct: 50 LCGR--HEKRLLNELLSSYNTLERPVA 74 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 24.6 bits (51), Expect = 0.89 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 684 LCARPAHKHALTHELLSSRRDSERPSA 604 LC R H+ L +ELLSS ERP A Sbjct: 50 LCGR--HEKRLLNELLSSYNTLERPVA 74 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 24.2 bits (50), Expect = 1.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -2 Query: 545 DYPNPCWGCLAPHAARLASE 486 DYP+P W + P A L ++ Sbjct: 130 DYPSPEWDTVTPEAKNLINQ 149 >AF487333-1|AAL93262.1| 80|Apis mellifera integrin betaPS protein. Length = 80 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = -2 Query: 554 LPADYPNPCWGCLAPHAARLASEARDSTTTSAS 456 +P PC GC AP+ + T+ AS Sbjct: 12 MPKSLKEPCDGCAAPYGYKNIMTLSQDTSHFAS 44 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 199 STEAISLKTFQQKSHR 246 S E ISL T QQK H+ Sbjct: 224 SDEDISLTTHQQKRHK 239 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 339 RRRRGSTWEAGCGKYRSHGPKARRCHHDRQ 428 + +R WE KY S G +R H Q Sbjct: 91 KTKRPKDWERLSAKYDSTGEYKKRYEHGLQ 120 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 339 RRRRGSTWEAGCGKYRSHGPKARRCHHDRQ 428 + +R WE KY S G +R H Q Sbjct: 91 KTKRPKDWERLSAKYDSTGEYKKRYEHGLQ 120 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 6.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -2 Query: 47 YCVSCGFH 24 YCV+CG H Sbjct: 542 YCVACGLH 549 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,931 Number of Sequences: 438 Number of extensions: 2838 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -