BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0646 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 24 1.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 1.1 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 1.1 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 1.1 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 1.1 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 1.1 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 1.1 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 1.1 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 24 1.1 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 1.1 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 24 1.4 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 22 4.4 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 92 LSASVPCGVNSTSNSPL 42 LS + PC +NSTS+ P+ Sbjct: 177 LSWNNPCSINSTSSQPV 193 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 51 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 108 Query: 14 SP 9 P Sbjct: 109 PP 110 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.1 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = -3 Query: 194 PSLVYLIGDPPS*IKVPNPVGVKKAGIPAPPARILSASVPCGVNSTSNSPLKNCLSNSAF 15 PS D S V +P + G APP S P N+T +S L + LS S Sbjct: 95 PSASCKYADSTSSTGVASPQDLSTNG--APPRSTPPLSTPSNSNATKSSGLTSPLSVSTS 152 Query: 14 SP 9 P Sbjct: 153 PP 154 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.8 bits (49), Expect = 1.4 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -3 Query: 185 VYLIGDPPS*IKVPNPVGVKKAGIPA--PPARILSASVPCGVNSTSNSPL 42 +Y PP+ P+ PA PP S+ P V S +++PL Sbjct: 6 IYEESPPPAPQSAATPISSSGMTSPAAAPPPATTSSGSPASVASNASAPL 55 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 22.2 bits (45), Expect = 4.4 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 129 KKGRNTCTSCTYSFCQC 79 +KG+ TC + + ++C C Sbjct: 34 QKGQKTCLNLSINYCIC 50 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,382 Number of Sequences: 336 Number of extensions: 3967 Number of successful extensions: 23 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -