BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0646 (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 25 3.1 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.5 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 24.6 bits (51), Expect = 3.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 212 LGISIFPSLVYLIGDPPS*IKVPNPVGVKKAGIPA 108 L +F V +IGDPP + PN V+ +PA Sbjct: 156 LTYQMFLHTVNIIGDPPRPVGAPNFEYVEFGRVPA 190 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 184 TKDGKIDIPSSARFVQQFNG 243 T G + IPS R++Q F+G Sbjct: 212 TVAGPLRIPSHRRYIQYFSG 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 773,789 Number of Sequences: 2352 Number of extensions: 16453 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -