BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0640 (695 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2A9.05c |||DUF846 family protein|Schizosaccharomyces pombe|c... 27 3.4 SPBC337.09 |erg28||Erg28 protein|Schizosaccharomyces pombe|chr 2... 25 7.8 SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 7.8 >SPBC2A9.05c |||DUF846 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 219 Score = 26.6 bits (56), Expect = 3.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 628 EGSPPSRPRHGCTPRTFFHWSFLY 557 E + PSRPR+ +TF++ +LY Sbjct: 121 ESADPSRPRNAVDQKTFWYALYLY 144 >SPBC337.09 |erg28||Erg28 protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 136 Score = 25.4 bits (53), Expect = 7.8 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = -2 Query: 601 HGCTPRTFFHWSFL------YCPSYPKH*EHFLISKAAFEVYCFHHDSKLELFR 458 +G RTF W+ L YC + + + + + + + + CFH S+ LFR Sbjct: 49 NGLQGRTFGIWTLLSAIVRFYCAYHITNPDVYFLCQCTYYLACFHFLSEWLLFR 102 >SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 661 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 606 GREGGLPSASARPGYPVHI 662 G GGL S A P YP HI Sbjct: 522 GSLGGLESTPAYPSYPSHI 540 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,621,203 Number of Sequences: 5004 Number of extensions: 50091 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -