BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0638 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44629| Best HMM Match : SoxD (HMM E-Value=3.6) 73 1e-13 SB_48142| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 >SB_44629| Best HMM Match : SoxD (HMM E-Value=3.6) Length = 115 Score = 73.3 bits (172), Expect = 1e-13 Identities = 43/117 (36%), Positives = 66/117 (56%), Gaps = 2/117 (1%) Frame = +3 Query: 291 LYPPEILKRLDFSKSPAKFHPK-ISAVDPGEDWMIVRPLQRSDYDKGFLQLLSQLTSVGN 467 L+ ++LK +D+SK K + +S PGED + +RPL DYDK Sbjct: 6 LFDADVLKEIDYSKGDCKMNQYGLSCESPGED-LRLRPLASDDYDK-------------- 50 Query: 468 ITRKQYDDRFTKMK-HSGGYYVTVIEDTRINKLIGAATLTIEQKFIHNCSLRGRLED 635 +RF M+ H G YY+ V+E+T+ +K++ + +L +EQKFIH +LRGR+ED Sbjct: 51 -------ERFNAMRDHHGTYYIIVVENTKADKILASGSLIVEQKFIHEIALRGRIED 100 >SB_48142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 339 PDSY*NPVFLISPEGKGIRRVSLPHFRSFPCPF 241 PDS PV+ + PEG G R ++L PC F Sbjct: 128 PDS---PVYELKPEGAGGRNITLQRNLLLPCDF 157 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,194,589 Number of Sequences: 59808 Number of extensions: 369372 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -