BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0637 (389 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39678-4|AAK39211.2| 330|Caenorhabditis elegans Hypothetical pr... 29 1.2 Z70780-10|CAA94827.1| 330|Caenorhabditis elegans Hypothetical p... 27 4.7 >U39678-4|AAK39211.2| 330|Caenorhabditis elegans Hypothetical protein C39D10.3a protein. Length = 330 Score = 29.1 bits (62), Expect = 1.2 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = +2 Query: 278 GRLMLSERRPRMQT----DFKSAALQRVLRPIQGQP 373 GRLML ++ M+T DFKSA L L P+ +P Sbjct: 115 GRLMLVTKKHHMETDSILDFKSAILPFALDPLSNEP 150 >Z70780-10|CAA94827.1| 330|Caenorhabditis elegans Hypothetical protein F46B6.11 protein. Length = 330 Score = 27.1 bits (57), Expect = 4.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 216 ASNMKVYALIVACLALGVLAEEDSCY 293 +SN+ Y ++ C+AL V A SCY Sbjct: 275 SSNLYAYMFLLRCIALDVRAHIVSCY 300 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,707,014 Number of Sequences: 27780 Number of extensions: 174114 Number of successful extensions: 364 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 587646290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -