BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0635 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 27 0.19 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 22 5.4 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 5.4 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 26.6 bits (56), Expect = 0.19 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 259 SSICTKCQRNSLERIAKL*QLDSAKKMLNWKKIKKQ 366 SS CTKC + E K+ + + K+ +W+++ K+ Sbjct: 71 SSGCTKCNQKQKETAEKVIRHLTQKRARDWERLSKK 106 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +1 Query: 262 SICTKCQRNSLERIAKL*QLDSAKKMLNWKKI 357 S C KC E K+ S K WK++ Sbjct: 68 SDCAKCSEKQKEMTKKVIHFLSHNKQQMWKEL 99 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.8 bits (44), Expect = 5.4 Identities = 6/35 (17%), Positives = 21/35 (60%) Frame = -2 Query: 200 MYISILFYYIYIHWERLYSLKLKDIHFVHSCTEYL 96 +++ ++ Y +I W+++ ++ ++ F + +YL Sbjct: 100 VFVVVMGYIGFIEWDKVEIVRSQEGRFEEAVIDYL 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,145 Number of Sequences: 336 Number of extensions: 2620 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -