BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0635 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual 29 0.63 SPAC1565.07c |||TATA binding protein interacting protein |Schizo... 26 5.9 >SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual Length = 1097 Score = 29.1 bits (62), Expect = 0.63 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +1 Query: 238 LCRYFLYSSICTKCQRNSLERIAKL*QLDSAKKMLN 345 +C+ LYSSICT C N + KL +L S +LN Sbjct: 501 VCQIILYSSICTSCSINESLK-TKLPKLISFGLLLN 535 >SPAC1565.07c |||TATA binding protein interacting protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1220 Score = 25.8 bits (54), Expect = 5.9 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = -1 Query: 450 FFLALPFSVVSS*VYHHYLPILHPLQLSLFFDLFPV*HFLCAVELL--QLCYSLQ*ISL 280 FF L S +YH L L P L D+F C EL+ + CY L +SL Sbjct: 144 FFAILCVVCDSLEIYHSNLSTLLPNNFELCIDVFQKCTTQCQRELIIKKACYLLSDVSL 202 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,317,988 Number of Sequences: 5004 Number of extensions: 42534 Number of successful extensions: 137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -