BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0635 (687 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g16210.1 68414.m01941 expressed protein ESTs gb|T04357 and gb... 32 0.31 At5g22130.1 68418.m02576 mannosyltransferase family protein simi... 31 0.72 At2g21800.1 68415.m02591 expressed protein 30 1.3 At5g34540.1 68418.m04035 hypothetical protein 28 6.7 At5g37110.1 68418.m04454 hypothetical protein 27 8.8 >At1g16210.1 68414.m01941 expressed protein ESTs gb|T04357 and gb|AA595092 come from this gene Length = 234 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 276 MPKKFTGENSKAVAARQRKENAKLEKDQKTKKAVEDAEWED 398 MPKK G NSKA A+ RK A+ E+ + + E+ W + Sbjct: 1 MPKKM-GLNSKAEVAKSRKNAAEAEQKDRQTREKEEQYWRE 40 >At5g22130.1 68418.m02576 mannosyltransferase family protein similar to mannosyltransferase from Rattus norvegicus [GI:11414877], Homo sapiens [GI:11414879]; contains Pfam profile PF05007: Mannosyltransferase (PIG-M) Length = 450 Score = 31.1 bits (67), Expect = 0.72 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = -2 Query: 254 RKYLHK-LC*NFTHALLLHMYISILFYYIYIHWERLYSLKLKDIHFVHSCT 105 +++LH+ L + T H + SI FY+IY+H+ER +S K I F+ T Sbjct: 267 QEFLHEALLYHLTRTDPRHNF-SIYFYHIYLHYERQFSAVEKLISFLPQFT 316 >At2g21800.1 68415.m02591 expressed protein Length = 475 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 276 MPKKFTGENSKAVAARQRKENAKLEKDQKTKKAVEDAE 389 +PKK ++ K AA ++K + EK QK EDAE Sbjct: 186 LPKKKMSKDEKTRAAEEKKLQKEQEKLQKAASKAEDAE 223 >At5g34540.1 68418.m04035 hypothetical protein Length = 260 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = +3 Query: 255 IFQYLHKMPKKFT-----GENSKAVAARQRKENAKLE-KDQKTKKAVED 383 IF+Y+HK P + T NSK ++K NA ++ + K K VED Sbjct: 93 IFKYIHKEPDRVTVVVESSLNSKNKEKGKQKVNADIDGSEPKKKNEVED 141 >At5g37110.1 68418.m04454 hypothetical protein Length = 1307 Score = 27.5 bits (58), Expect = 8.8 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = +3 Query: 255 IFQYLHKMPKKFT-----GENSKAVAARQRKENAKLE-KDQKTKKAVED 383 IF+Y+HK P + T NSK ++K+NA + + K K VED Sbjct: 619 IFKYIHKGPDRVTVVVESSLNSKNKENGKQKDNADTDGSETKKKNEVED 667 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,906,850 Number of Sequences: 28952 Number of extensions: 210929 Number of successful extensions: 571 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -