BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0631 (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_02_0039 - 10490522-10490606,10490674-10490810,10491107-104912... 132 2e-31 05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970,211... 131 5e-31 05_07_0145 + 28012268-28012624,28012734-28012794,28013758-280138... 128 5e-30 01_05_0795 + 25287449-25287967,25288078-25288138,25288640-252887... 125 3e-29 01_06_0158 - 27079262-27079346,27079662-27079750,27080540-270806... 122 2e-28 11_02_0009 - 7315669-7315686,7316239-7316259,7316425-7316519,731... 53 2e-07 02_05_0763 + 31583449-31583747,31584095-31584230,31584544-315845... 43 2e-04 09_06_0239 - 21794691-21795986 41 0.001 05_06_0040 + 25116732-25118030 41 0.001 01_01_0555 + 4080316-4081680 41 0.001 07_03_0712 - 20878272-20879633 40 0.001 06_03_0732 + 23965090-23965431,23965610-23965746,23967359-239674... 40 0.002 07_03_0705 - 20846810-20848165 40 0.002 07_03_0704 + 20831071-20832381 40 0.002 07_03_0708 - 20865786-20867153 39 0.004 04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861,854... 38 0.005 09_06_0132 - 21042653-21042873,21042950-21043027,21043106-210431... 38 0.007 01_06_0523 - 30009191-30010531 38 0.007 12_01_0940 - 9303549-9303723,9303816-9303893,9304055-9304110,930... 37 0.012 05_07_0313 - 29159638-29161065 37 0.012 03_02_0811 + 11437654-11438958 37 0.012 09_04_0549 + 18478475-18478664,18479381-18480648 37 0.016 09_04_0547 + 18467016-18467205,18467922-18469189 37 0.016 04_04_1647 + 35032328-35033803 37 0.016 02_05_0552 - 29911280-29912541,29912633-29912762 37 0.016 04_02_0002 + 8412568-8412781,8412915-8413015,8413114-8413185,841... 36 0.021 03_02_0806 + 11391880-11391916,11392247-11393634 36 0.021 12_01_0345 - 2649701-2650819 36 0.028 06_03_1412 + 29993566-29993873,29993960-29994583,29994665-299948... 36 0.028 03_02_0809 + 11419318-11420493 36 0.036 03_02_0807 + 11398845-11399999 36 0.036 02_05_0626 - 30456714-30456829,30456951-30457023,30457136-304572... 36 0.036 01_06_0258 + 27950196-27950749,27953670-27954570 36 0.036 01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 36 0.036 09_04_0355 + 16922863-16924224 35 0.048 09_04_0353 + 16915618-16916934 35 0.048 04_04_0042 + 22328464-22329858 35 0.048 04_03_0432 - 15861997-15862096,15862449-15862519,15862612-158627... 35 0.048 01_06_0905 + 32880368-32880633,32882439-32882568,32882704-328828... 35 0.048 05_04_0147 - 18419864-18421297 35 0.064 11_01_0539 + 4268326-4268450,4268586-4268751 34 0.11 04_04_0040 + 22322839-22324173 34 0.11 05_04_0099 - 17991569-17993014 33 0.15 04_03_0428 - 15820169-15820236,15820296-15820367,15820450-158205... 33 0.15 04_03_0418 - 15686775-15686842,15686902-15686973,15687056-156871... 33 0.15 02_03_0194 - 16215032-16215177,16215322-16215393,16215518-162155... 33 0.15 02_02_0636 + 12463660-12465204 33 0.15 12_02_0913 + 24246217-24247557 33 0.19 07_03_0710 - 20873420-20874745 33 0.19 06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253,896... 33 0.19 02_05_0551 + 29907768-29907909,29907995-29909280 33 0.19 12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896,393... 33 0.26 06_01_0746 + 5580755-5582119 33 0.26 01_01_0261 + 2119519-2121033 33 0.26 08_01_0711 - 6275052-6276401 32 0.34 05_07_0071 - 27481876-27482737,27484328-27484950 32 0.34 04_04_1586 - 34621945-34623366 32 0.34 10_08_0770 + 20459888-20461036 32 0.45 08_02_0960 + 23058393-23059739 32 0.45 04_01_0509 + 6668208-6668653,6669776-6669779 32 0.45 03_02_0519 + 9066918-9068261 32 0.45 01_06_1318 - 36261483-36262811 32 0.45 07_03_1115 - 24076506-24076677,24077169-24077266,24077622-240777... 31 0.59 04_03_0316 + 14261942-14262506,14262710-14263134 31 0.59 10_08_0774 + 20478203-20479393 31 0.78 01_05_0596 + 23511148-23512650 31 0.78 10_08_0769 + 20452130-20453314 31 1.0 10_08_0766 + 20437772-20438956 31 1.0 01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 31 1.0 10_08_0775 + 20484776-20486035 30 1.4 02_05_0554 + 29929860-29929959,29932944-29934220 30 1.4 06_01_0772 + 5770502-5770619,5771035-5772335 30 1.8 10_08_0773 + 20474642-20475835 29 3.2 10_08_0772 + 20471748-20473004 29 3.2 08_02_1095 - 24278295-24278741,24279066-24279307,24279647-242797... 29 3.2 04_04_1013 + 30109321-30110790 29 4.2 04_04_1006 + 30048618-30050087 29 4.2 03_02_0810 + 11429776-11429985,11430003-11430935 29 4.2 01_07_0213 - 42028941-42029055,42029444-42029480,42029876-420302... 29 4.2 10_08_0778 + 20492822-20493920,20494605-20494648 28 5.5 11_01_0720 - 5943243-5944399,5946142-5946271 28 7.3 11_01_0534 + 4227838-4228001,4229034-4229151,4229593-4229752,422... 28 7.3 10_08_0083 - 14715517-14715595,14716022-14716150,14716280-147164... 28 7.3 10_08_0771 + 20463872-20465113 27 9.7 07_03_1556 + 27692770-27694119 27 9.7 01_06_1068 - 34270420-34270581,34272185-34272238,34273741-34274070 27 9.7 >01_02_0039 - 10490522-10490606,10490674-10490810,10491107-10491248, 10491355-10491419,10491528-10491641,10491846-10492119, 10492215-10492327,10492405-10492499,10492602-10492662, 10492774-10493103 Length = 471 Score = 132 bits (320), Expect = 2e-31 Identities = 62/104 (59%), Positives = 74/104 (71%) Frame = +1 Query: 334 RLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC 513 RL+ D G PL NYLD QY+G I IGTPPQ+F V+FDTGSSNLWVPS KC Y +IAC Sbjct: 55 RLRADGLGDDIVPLDNYLDTQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSVKC-YFSIAC 113 Query: 514 LLHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGL 645 LH++Y S+ S +Y NG +I YGSGS++GF S D V VG L Sbjct: 114 YLHHRYKSKGSSSYKKNGESCSISYGSGSIAGFFSEDSVLVGDL 157 >05_01_0273 + 2115257-2115589,2115706-2115766,2115876-2115970, 2116072-2116184,2116278-2116551,2116923-2117036, 2117169-2117233,2117325-2117466,2117547-2117666, 2118153-2118241,2118349-2118433 Length = 496 Score = 131 bits (316), Expect = 5e-31 Identities = 60/103 (58%), Positives = 77/103 (74%) Frame = +1 Query: 337 LKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACL 516 LK + P PL +YL+ QYYGVI +G+PPQ+F V+FDTGSSNLWVPS KC Y +IAC Sbjct: 57 LKTGSSDSDPVPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKC-YFSIACY 115 Query: 517 LHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGL 645 LH++Y+S+KS +Y A+G I YGSG++SGF S D+V VG L Sbjct: 116 LHSRYNSKKSSSYKADGETCKITYGSGAISGFFSKDNVLVGDL 158 >05_07_0145 + 28012268-28012624,28012734-28012794,28013758-28013852, 28013944-28014056,28014436-28014604,28014677-28014716, 28014797-28014861,28015485-28015598,28015687-28015751, 28015927-28016083,28016167-28016286,28016447-28016535, 28016631-28016715 Length = 509 Score = 128 bits (308), Expect = 5e-30 Identities = 57/91 (62%), Positives = 69/91 (75%) Frame = +1 Query: 373 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 552 L NY++AQY+G I +GTPPQ F V+FDTGSSNLWVPS KC Y +IAC H++Y S +S T Sbjct: 77 LKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKC-YFSIACFFHSRYKSGQSST 135 Query: 553 YVANGTQFAIQYGSGSLSGFLSTDDVTVGGL 645 Y NG AIQYG+GS++GF S D VTVG L Sbjct: 136 YQKNGKPAAIQYGTGSIAGFFSEDSVTVGDL 166 >01_05_0795 + 25287449-25287967,25288078-25288138,25288640-25288734, 25288827-25288939,25289480-25289648,25289777-25289816, 25289906-25289970,25290150-25290263,25290398-25290462, 25290572-25290725,25290798-25290914,25292489-25292545 Length = 522 Score = 125 bits (302), Expect = 3e-29 Identities = 55/94 (58%), Positives = 70/94 (74%) Frame = +1 Query: 364 PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRK 543 P L N+L+AQY+G I +G PPQ+F VVFDTGSSNLWVPS KC + ++AC H KY+SR Sbjct: 128 PLALKNFLNAQYFGEIGVGCPPQNFTVVFDTGSSNLWVPSAKCVF-SLACYFHRKYESRS 186 Query: 544 SKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGL 645 S TY+ NGT +I YG+GS+ G+ S D VT+G L Sbjct: 187 SSTYMENGTPASIHYGTGSIHGYYSQDQVTIGDL 220 >01_06_0158 - 27079262-27079346,27079662-27079750,27080540-27080659, 27080738-27080894,27081167-27081231,27081323-27081436, 27082109-27082178,27082412-27082642,27082963-27083039, 27083143-27083237,27084514-27084574,27084678-27085073 Length = 519 Score = 122 bits (294), Expect = 2e-28 Identities = 54/89 (60%), Positives = 67/89 (75%) Frame = +1 Query: 373 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 552 L NYL+AQYYG I+IGTPPQ F V+FDTGSSNLWVPS KCH +IAC H++Y + +S T Sbjct: 90 LKNYLNAQYYGEIAIGTPPQMFTVIFDTGSSNLWVPSSKCH-LSIACYFHSRYKAGQSST 148 Query: 553 YVANGTQFAIQYGSGSLSGFLSTDDVTVG 639 Y NG +I YG+G++SG+ S D V VG Sbjct: 149 YKKNGKPASIHYGTGAISGYFSQDSVKVG 177 >11_02_0009 - 7315669-7315686,7316239-7316259,7316425-7316519, 7317445-7317502,7317701-7317792,7318101-7318227 Length = 136 Score = 52.8 bits (121), Expect = 2e-07 Identities = 27/55 (49%), Positives = 32/55 (58%) Frame = +1 Query: 481 SKKCHYTNIACLLHNKYDSRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGGL 645 S C IAC H +Y S + TY NG AIQYG+GS+ GF + D VTVG L Sbjct: 66 SLTCCSFYIACFFH-RYKSEQPSTYRKNGKPAAIQYGTGSVDGFFNEDSVTVGDL 119 >02_05_0763 + 31583449-31583747,31584095-31584230,31584544-31584593, 31585586-31585852,31586481-31586708,31586873-31587011, 31587091-31587161,31587313-31587412,31588201-31588264, 31588346-31588417,31588500-31588720 Length = 548 Score = 43.2 bits (97), Expect = 2e-04 Identities = 31/76 (40%), Positives = 35/76 (46%) Frame = +1 Query: 253 ALYRVPLHRMKTARTHFHEVGTELELLRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQ 432 AL R L R K VG + +LL L G S P N L YY + +GTP Sbjct: 63 ALVRSDLQRQK------RRVGGKYQLLSLSQ---GGSIFPSGNDLGWLYYTWVDVGTPNT 113 Query: 433 SFKVVFDTGSSNLWVP 480 SF V DTGS WVP Sbjct: 114 SFLVALDTGSDLFWVP 129 >09_06_0239 - 21794691-21795986 Length = 431 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 4/83 (4%) Frame = +1 Query: 409 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLH--NKYDSRKSKTYV-ANGTQFA 579 + IGTP + +VFDT S LW + C ++C+ + YD K++TY + + Sbjct: 92 LGIGTPAMNVTLVFDTTSDLLWTQCQPC----LSCVAQAGDMYDPNKTETYANLTSSSYN 147 Query: 580 IQYGSGSL-SGFLSTDDVTVGGL 645 Y S SG+ +T+ +G + Sbjct: 148 YTYSKQSFTSGYFATETFALGNV 170 >05_06_0040 + 25116732-25118030 Length = 432 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +1 Query: 367 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 480 EP++ Y D Y +++G PPQ F+V DTGS WVP Sbjct: 16 EPVTTYTDG-YLLSLNLGMPPQVFQVYLDTGSDLTWVP 52 >01_01_0555 + 4080316-4081680 Length = 454 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY-TNIACLLHNKYDSRKSKTY 555 +Y +++G+PP+S + DTGS +WV KK + T+ A ++D +S TY Sbjct: 100 EYLMTVNLGSPPRSMLAIADTGSDLVWVKCKKGNNDTSSAAAPTTQFDPSRSSTY 154 >07_03_0712 - 20878272-20879633 Length = 453 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +1 Query: 349 VTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 V+ P+ + L N +Y ++IGTPPQS+ + DTGS +W C Sbjct: 78 VSAPTRKDLPN--GGEYIMTLAIGTPPQSYPAIADTGSDLVWTQCAPC 123 >06_03_0732 + 23965090-23965431,23965610-23965746,23967359-23967417, 23968817-23970135 Length = 618 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 21/101 (20%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTYV---- 558 Y + +GTP + VVFDTGS WV + C +AC + +D S TY Sbjct: 282 YVVTVGLGTPASRYTVVFDTGSDTTWVQCQPC---VVACYEQREKLFDPASSSTYANVSC 338 Query: 559 ---------ANGTQ-----FAIQYGSGSLS-GFLSTDDVTV 636 +G + +QYG GS S GF + D +T+ Sbjct: 339 AAPACSDLDVSGCSGGHCLYGVQYGDGSYSIGFFAMDTLTL 379 >07_03_0705 - 20846810-20848165 Length = 451 Score = 39.5 bits (88), Expect = 0.002 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 18/96 (18%) Frame = +1 Query: 409 ISIGTPPQSFKVVFDTGSSNLWV-----------------PSKKCHYTNIACLLH-NKYD 534 +SIGTPP +F V+ DTGSS +W P+ ++ + C ++ Sbjct: 94 LSIGTPPVTFSVLADTGSSLIWTQCAPCTECAARPAPPFQPASSSTFSKLPCASSLCQFL 153 Query: 535 SRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVGG 642 + T A G + YG G +G+L+T+ + VGG Sbjct: 154 TSPYLTCNATGCVYYYPYGMGFTAGYLATETLHVGG 189 >07_03_0704 + 20831071-20832381 Length = 436 Score = 39.5 bits (88), Expect = 0.002 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 18/95 (18%) Frame = +1 Query: 409 ISIGTPPQSFKVVFDTGSSNLW---VPSKKCH--------------YTNIACL-LHNKYD 534 IS+GTP +F VV DTGS +W P KC ++ + C ++ Sbjct: 90 ISVGTPLLTFSVVADTGSDLIWTQCAPCTKCFQQPAPPFQPASSSTFSKLPCTSSFCQFL 149 Query: 535 SRKSKTYVANGTQFAIQYGSGSLSGFLSTDDVTVG 639 +T A G + +YGSG +G+L+T+ + VG Sbjct: 150 PNSIRTCNATGCVYNYKYGSGYTAGYLATETLKVG 184 >07_03_0708 - 20865786-20867153 Length = 455 Score = 38.7 bits (86), Expect = 0.004 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 23/100 (23%) Frame = +1 Query: 409 ISIGTPPQSFKVVFDTGSSNLWV-------------------PSKKCHYTNIACL-LHNK 528 IS+GTPP F V+ DTGS+ +W P++ ++ + C + Sbjct: 95 ISLGTPPLDFPVIVDTGSNLIWAQCAPCTRCFPRPTPAPVLQPARSSTFSRLPCNGSFCQ 154 Query: 529 YDSRKSKTYVANGT---QFAIQYGSGSLSGFLSTDDVTVG 639 Y S+ N T + YGSG +G+L+T+ +TVG Sbjct: 155 YLPTSSRPRTCNATAACAYNYTYGSGYTAGYLATETLTVG 194 >04_02_0012 + 8537124-8537464,8537558-8537693,8538811-8538861, 8540190-8540413,8540491-8540715,8541520-8541619, 8541703-8541763,8543029-8543100,8543183-8543406 Length = 477 Score = 38.3 bits (85), Expect = 0.005 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVP 480 +Y ++++GTP Q+F V DTGS W+P Sbjct: 116 HYALVTVGTPGQTFMVALDTGSDLFWLP 143 >09_06_0132 - 21042653-21042873,21042950-21043027,21043106-21043167, 21043504-21043578,21043664-21043752,21043825-21043905, 21044939-21045076,21046299-21046429,21046521-21046592, 21047218-21047275,21047362-21047461,21047544-21047617, 21047701-21047836,21047913-21048137,21048211-21048446, 21048949-21049081,21049195-21049484 Length = 732 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 555 +Y V+++GTP +F V DTGS WVP C A Y S K Y Sbjct: 99 HYAVVALGTPNVTFLVALDTGSDLFWVP---CDCLKCAPFQSPNYGSLKFDVY 148 >01_06_0523 - 30009191-30010531 Length = 446 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +1 Query: 346 DVTGPSPEPLSN---YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACL 516 D TG P+ + + +Y+ ++ +GTP +V DTGS +W+ C Sbjct: 66 DATGRLHSPVFSGIPFESGEYFALVGVGTPSTKAMLVIDTGSDLVWLQCSPCR--RCYAQ 123 Query: 517 LHNKYDSRKSKTY 555 +D R+S TY Sbjct: 124 RGQVFDPRRSSTY 136 >12_01_0940 - 9303549-9303723,9303816-9303893,9304055-9304110, 9304687-9304760,9304888-9304892,9304934-9304971, 9308558-9308578,9308764-9308858,9309989-9310115 Length = 222 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 556 VANGTQFAIQYGSGSLSGFLSTDDVTVGGL 645 + +G AIQYG+GS+ GF + D VTVG L Sbjct: 40 MTDGKPAAIQYGTGSVDGFFNEDSVTVGDL 69 >05_07_0313 - 29159638-29161065 Length = 475 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVA 561 +Y+ + +GTP + +V DTGS +W+ C + +D R+S++Y A Sbjct: 121 EYFAQVGVGTPATTALMVLDTGSDVVWLQCAPCRHCYAQS--GRVFDPRRSRSYAA 174 >03_02_0811 + 11437654-11438958 Length = 434 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +1 Query: 334 RLKYDVTGP-SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 RL + P SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 59 RLSSSASAPVSPGTYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 113 >09_04_0549 + 18478475-18478664,18479381-18480648 Length = 485 Score = 36.7 bits (81), Expect = 0.016 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >09_04_0547 + 18467016-18467205,18467922-18469189 Length = 485 Score = 36.7 bits (81), Expect = 0.016 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y + +GTP + + V+FDTGS WV K C Sbjct: 149 YVVSVGLGTPAKQYAVIFDTGSDLSWVQCKPC 180 >04_04_1647 + 35032328-35033803 Length = 491 Score = 36.7 bits (81), Expect = 0.016 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = +1 Query: 352 TGPSPEPLSNYLDAQYYG---VISIGTPPQSFKVVFDTGSSNLWVP 480 T P P ++ Y G +S+GTPPQ V+ +TGS WVP Sbjct: 71 TAPPPSVRASLYPHSYGGYAFTVSLGTPPQPLPVLLETGSHLSWVP 116 >02_05_0552 - 29911280-29912541,29912633-29912762 Length = 463 Score = 36.7 bits (81), Expect = 0.016 Identities = 36/122 (29%), Positives = 48/122 (39%), Gaps = 24/122 (19%) Frame = +1 Query: 349 VTGPSPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN 525 V+ P L + LD Y + + +GTP + V DTGS WV C Sbjct: 110 VSSSVPTKLGSSLDTLEYVISVGLGTPAVTQTVTIDTGSDVSWVQCNPCPNPPCYAQTGA 169 Query: 526 KYDSRKSKTYVA---------------NG-------TQFAIQYGSGS-LSGFLSTDDVTV 636 +D KS TY A NG Q+ +QYG GS +G S D +T+ Sbjct: 170 LFDPAKSSTYRAVSCAAAECAQLEQQGNGCGATNYECQYGVQYGDGSTTNGTYSRDTLTL 229 Query: 637 GG 642 G Sbjct: 230 SG 231 >04_02_0002 + 8412568-8412781,8412915-8413015,8413114-8413185, 8413267-8413380,8414248-8414269,8414450-8414598, 8415054-8415203,8415369-8415401,8418268-8418474 Length = 353 Score = 36.3 bits (80), Expect = 0.021 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +1 Query: 565 GTQFAIQYGSGSLSGFLSTDDVTVGGL 645 G AIQYG+GS++GF + D VT+G L Sbjct: 243 GKPAAIQYGNGSVAGFFNEDSVTIGDL 269 >03_02_0806 + 11391880-11391916,11392247-11393634 Length = 474 Score = 36.3 bits (80), Expect = 0.021 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 388 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 D +Y ++IGTPPQ +++ DTGS W C Sbjct: 108 DTEYLVHMAIGTPPQPVQLILDTGSDLTWTQCAPC 142 >12_01_0345 - 2649701-2650819 Length = 372 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y+ IS+GTPP V DTGS+ WV K C Sbjct: 24 KYFMGISLGTPPVFNLVTIDTGSTLSWVQCKNC 56 >06_03_1412 + 29993566-29993873,29993960-29994583,29994665-29994800, 29995108-29995196,29995299-29995413,29995565-29995628, 29995711-29995782,29995906-29996153 Length = 551 Score = 35.9 bits (79), Expect = 0.028 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVP--SKKC 492 +Y +++GTP +F V DTGS WVP K+C Sbjct: 105 HYAEVAVGTPNTTFLVALDTGSDLFWVPCDCKQC 138 >03_02_0809 + 11419318-11420493 Length = 391 Score = 35.5 bits (78), Expect = 0.036 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 361 SPEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 SP N + Y V ++IGTPPQ ++ DTGS +W + C Sbjct: 22 SPGAYDNGVPTTEYLVHLAIGTPPQPVQLTLDTGSDLIWTQCQPC 66 >03_02_0807 + 11398845-11399999 Length = 384 Score = 35.5 bits (78), Expect = 0.036 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 555 +Y ++IGTPPQ ++ DTGS +W + C L + YD+ +S T+ Sbjct: 34 EYLLHLAIGTPPQPVQLTLDTGSVLVWTQCQPCAVCFNQSLPY--YDASRSSTF 85 >02_05_0626 - 30456714-30456829,30456951-30457023,30457136-30457250, 30457368-30457450,30457532-30457685,30457859-30458095, 30458212-30458435,30458657-30458774,30459286-30459614 Length = 482 Score = 35.5 bits (78), Expect = 0.036 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +1 Query: 388 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 549 D QYY I +G PP+ + + DTGS W+ TN A H Y K K Sbjct: 109 DGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQC-DAPCTNCAKGPHPLYKPAKEK 161 >01_06_0258 + 27950196-27950749,27953670-27954570 Length = 484 Score = 35.5 bits (78), Expect = 0.036 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 495 QY+ +GTP Q F +V DTGS WV KCH Sbjct: 86 QYFVRFRVGTPAQPFLLVADTGSDLTWV---KCH 116 >01_05_0656 + 24011784-24011844,24012737-24012862,24014761-24016052 Length = 492 Score = 35.5 bits (78), Expect = 0.036 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = +1 Query: 364 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLH--NKYD 534 P L + LD Y + + +G+P + +VV DTGS WV + C + C H +D Sbjct: 136 PTTLGSSLDTLEYVISVGLGSPAVTQRVVIDTGSDVSWVQCEPCPAPS-PCHAHAGALFD 194 Query: 535 SRKSKTYVA 561 S TY A Sbjct: 195 PAASSTYAA 203 >09_04_0355 + 16922863-16924224 Length = 453 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 388 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 D +Y +++GTPPQ + DTGS +W C Sbjct: 95 DLEYVLDLAVGTPPQPITALLDTGSDLIWTQCDTC 129 >09_04_0353 + 16915618-16916934 Length = 438 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 373 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 L + + +Y + IG+PP+ F + DTGS +W C Sbjct: 77 LLRFSEGEYLMDVGIGSPPRYFSAMIDTGSDLIWTQCAPC 116 >04_04_0042 + 22328464-22329858 Length = 464 Score = 35.1 bits (77), Expect = 0.048 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVA 561 +Y + IGTPP F DT S +W + C T + ++ R S TY A Sbjct: 88 EYLVKLGIGTPPYKFTAAIDTASDLIWTQCQPC--TGCYHQVDPMFNPRVSSTYAA 141 >04_03_0432 - 15861997-15862096,15862449-15862519,15862612-15862774, 15865311-15865535,15866156-15866403,15866489-15866618, 15866716-15866975 Length = 398 Score = 35.1 bits (77), Expect = 0.048 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 YY I IGTP + + V DTGS LWV C Sbjct: 89 YYTEIGIGTPTKRYYVQVDTGSDILWVNCISC 120 >01_06_0905 + 32880368-32880633,32882439-32882568,32882704-32882894, 32883625-32883852,32884062-32884224,32884343-32884416, 32884484-32884601,32884722-32884788,32885152-32885223, 32885350-32885513 Length = 490 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y+ + +G+PP+ + V DTGS LWV C Sbjct: 91 YFTRVKLGSPPKEYFVQIDTGSDILWVACSPC 122 >05_04_0147 - 18419864-18421297 Length = 477 Score = 34.7 bits (76), Expect = 0.064 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 358 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 PS P + Y + +GTPPQ FD S +WVP ++C Sbjct: 76 PSQAPATT--GGTYLITVGVGTPPQYVYGAFDISSQFVWVPCEEC 118 >11_01_0539 + 4268326-4268450,4268586-4268751 Length = 96 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 4/53 (7%) Frame = +1 Query: 382 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWV----PSKKCHYTNIACLLHNK 528 Y +++ ++IG P + + + DTGS WV P + CH +A LL K Sbjct: 39 YPSGRFFVTMNIGVPEKPYFLDIDTGSDLTWVECDAPCQSCHQACVALLLTPK 91 >04_04_0040 + 22322839-22324173 Length = 444 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 409 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 555 +SIGTP ++ + DTGS +W K C + C + +D S TY Sbjct: 99 VSIGTPALAYSAIVDTGSDLVWTQCKPC----VDCFKQSTPVFDPSSSSTY 145 >05_04_0099 - 17991569-17993014 Length = 481 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 QY IG PPQ + V DTGS +W C Sbjct: 77 QYIASYGIGDPPQPAEAVVDTGSDLVWTQCSTC 109 >04_03_0428 - 15820169-15820236,15820296-15820367,15820450-15820519, 15824222-15824312,15825023-15825093,15825176-15825341, 15826169-15826393,15829075-15829307,15829464-15829618, 15829636-15829855 Length = 456 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >04_03_0418 - 15686775-15686842,15686902-15686973,15687056-15687125, 15690828-15690918,15691629-15691699,15691782-15691947, 15692775-15692999,15695681-15695913,15696070-15696224, 15696242-15696461 Length = 456 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 YY I IGTP + V DTGS WV C Sbjct: 84 YYTDIGIGTPAVKYYVQLDTGSKAFWVNGISC 115 >02_03_0194 - 16215032-16215177,16215322-16215393,16215518-16215593, 16215984-16216074,16216188-16216258,16216344-16216506, 16218841-16219065,16219206-16219507,16219551-16219680, 16219783-16220045 Length = 512 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y+ I IGTP + + V DTGS LWV C Sbjct: 90 YFTRIGIGTPAKRYYVQVDTGSDILWVNCVSC 121 >02_02_0636 + 12463660-12465204 Length = 514 Score = 33.5 bits (73), Expect = 0.15 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y + +GTPP+ F+++ DTGS W+ C Sbjct: 151 EYLVDLYVGTPPRRFQMIMDTGSDLNWLQCAPC 183 >12_02_0913 + 24246217-24247557 Length = 446 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 555 QY IG PPQ + + DTGS +W C A Y+S S T+ Sbjct: 89 QYVAEYLIGDPPQRAEALIDTGSDLVWTQCSTCLRKVCARQALPYYNSSASSTF 142 >07_03_0710 - 20873420-20874745 Length = 441 Score = 33.1 bits (72), Expect = 0.19 Identities = 31/105 (29%), Positives = 44/105 (41%), Gaps = 22/105 (20%) Frame = +1 Query: 391 AQYYGVISIGTPPQSFKVVFDTGSSNLW----VPSKKCH--------------YTNIACL 516 A Y I+IGTPP V DTGS +W P ++C Y N++C Sbjct: 90 ATYLVDIAIGTPPLPLTAVLDTGSDLIWTQCDAPCRRCFPQPAPLYAPARSATYANVSCR 149 Query: 517 --LHNKYDSRKSKTYVAN-GTQFAIQYGSG-SLSGFLSTDDVTVG 639 + S S+ + G + YG G S G L+T+ T+G Sbjct: 150 SPMCQALQSPWSRCSPPDTGCAYYFSYGDGTSTDGVLATETFTLG 194 >06_01_1092 + 8966584-8967053,8967737-8967854,8968030-8968253, 8968352-8968588,8969122-8969275,8969356-8969438, 8969573-8969687,8969837-8969909,8970005-8970147 Length = 538 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 388 DAQYYGVISIGTPPQSFKVVFDTGSSNLWV 477 D QYY + IG PP+ + + DTGS W+ Sbjct: 156 DGQYYTSMYIGNPPRPYFLDVDTGSDLTWI 185 >02_05_0551 + 29907768-29907909,29907995-29909280 Length = 475 Score = 33.1 bits (72), Expect = 0.19 Identities = 18/56 (32%), Positives = 25/56 (44%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVA 561 QY +S+GTP + + DTGS WV K C +D +S +Y A Sbjct: 141 QYVVTVSLGTPAVAQTLEVDTGSDVSWVQCKPCPSPPCYSQRDPLFDPTRSSSYSA 196 >12_01_0494 + 3931664-3931830,3932034-3932151,3932661-3932896, 3932992-3933225,3933659-3933797,3933878-3934096, 3934148-3934220,3934319-3934428 Length = 431 Score = 32.7 bits (71), Expect = 0.26 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 382 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC--LLHNKYDSRKSK 549 Y YY +SIG PP+ + + DTGS W+ +C ++C + H Y K+K Sbjct: 53 YPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWL---QCDAPCVSCSKVPHPLYRPTKNK 107 >06_01_0746 + 5580755-5582119 Length = 454 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y +S+GTPP+ + DTGS +W C Sbjct: 89 EYLMHVSVGTPPRPVALTLDTGSDLVWTQCAPC 121 >01_01_0261 + 2119519-2121033 Length = 504 Score = 32.7 bits (71), Expect = 0.26 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y+ + +G+P + +V DTGS WV + C Sbjct: 166 EYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPC 198 >08_01_0711 - 6275052-6276401 Length = 449 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +1 Query: 370 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 549 P Y D Y + IG Q ++ DTGSS +W +C + +I + Y +S+ Sbjct: 73 PFRIYEDVVYLAEMEIGERQQKQYLLIDTGSSLVWTQCDECPHCHIGDV--PPYGRSQSR 130 Query: 550 TY 555 T+ Sbjct: 131 TF 132 >05_07_0071 - 27481876-27482737,27484328-27484950 Length = 494 Score = 32.3 bits (70), Expect = 0.34 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWV 477 QY+ +GTP Q F ++ DTGS WV Sbjct: 109 QYFVRFRVGTPAQPFVLIADTGSDLTWV 136 >04_04_1586 - 34621945-34623366 Length = 473 Score = 32.3 bits (70), Expect = 0.34 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y+ + +G+PP +V D+GS +WV + C Sbjct: 129 EYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPC 161 >10_08_0770 + 20459888-20461036 Length = 382 Score = 31.9 bits (69), Expect = 0.45 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +1 Query: 394 QYYGVIS--IGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 555 + Y V S IGTPPQ D G +W +C ++ +D KS TY Sbjct: 21 ELYNVASFTIGTPPQPASAFIDVGGLLVWTQCSQCSSSSCFNQELPPFDPTKSSTY 76 >08_02_0960 + 23058393-23059739 Length = 448 Score = 31.9 bits (69), Expect = 0.45 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y ++IGTPP + + DTGS +W C Sbjct: 91 EYLMDLAIGTPPLRYTAMVDTGSDLIWTQCAPC 123 >04_01_0509 + 6668208-6668653,6669776-6669779 Length = 149 Score = 31.9 bits (69), Expect = 0.45 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y+ IG PPQ + + DTGS+ +W C Sbjct: 80 EYFTEYLIGDPPQHAEAIVDTGSNLVWTQCTDC 112 >03_02_0519 + 9066918-9068261 Length = 447 Score = 31.9 bits (69), Expect = 0.45 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 409 ISIGTPPQSFKVVFDTGSSNLWV 477 +++GTPPQ+ +V DTGS W+ Sbjct: 59 VAVGTPPQNVTMVLDTGSELSWL 81 >01_06_1318 - 36261483-36262811 Length = 442 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +1 Query: 331 LRLKYDVTGPSPEPLSN---YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWV 477 LR + G P P S + + +++GTPPQ+ +V DTGS W+ Sbjct: 41 LRARQVPAGALPRPASKLRFHHNVSLTVSLAVGTPPQNVTMVLDTGSELSWL 92 >07_03_1115 - 24076506-24076677,24077169-24077266,24077622-24077743, 24079059-24079235,24079809-24079897,24079919-24079965, 24080423-24080519,24080600-24080682,24080716-24080796, 24081043-24081199,24081323-24081750,24081985-24082014, 24083180-24083300,24083432-24083697 Length = 655 Score = 31.5 bits (68), Expect = 0.59 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 397 YYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 YY + IGTP Q F ++ D+GS+ +VP C Sbjct: 90 YYTTRLYIGTPSQEFALIVDSGSTVTYVPCATC 122 >04_03_0316 + 14261942-14262506,14262710-14263134 Length = 329 Score = 31.5 bits (68), Expect = 0.59 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 +Y ++ GTP Q ++ DTGS W K+C Sbjct: 43 EYLVHLAAGTPRQEVQLTLDTGSDIAWTQCKRC 75 >10_08_0774 + 20478203-20479393 Length = 396 Score = 31.1 bits (67), Expect = 0.78 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 3/86 (3%) Frame = +1 Query: 226 LALIASSVMALYRVPLHRMKTARTHFHEVGTELELLRLKYDVTGPSPEPLS---NYLDAQ 396 +A + S+++ + +PL T HE+ LEL D T P ++ ++ A Sbjct: 1 MASLVSTLLLMCLIPL-------TRAHELRRGLELAD---DATTARPGGVTVPVHFSQAF 50 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLW 474 Y ++IGTPPQ + D G +W Sbjct: 51 YVVNLTIGTPPQPVSAIIDIGGELVW 76 >01_05_0596 + 23511148-23512650 Length = 500 Score = 31.1 bits (67), Expect = 0.78 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +1 Query: 394 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCH 495 +Y+ I +GTP +V DTGS +W+ P ++C+ Sbjct: 146 EYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCY 182 >10_08_0769 + 20452130-20453314 Length = 394 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >10_08_0766 + 20437772-20438956 Length = 394 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y +IGTPPQ V D +W K+C Sbjct: 51 YVANFTIGTPPQPASAVIDLAGELVWTQCKQC 82 >01_06_1474 + 37630471-37631736,37631965-37632028,37632928-37633124 Length = 508 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +1 Query: 355 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 G S +P +N Y S+GTPPQ V D S +W+ C Sbjct: 85 GQSQDPATN--TGMYVLSFSVGTPPQVVTGVLDITSDFVWMQCSAC 128 >10_08_0775 + 20484776-20486035 Length = 419 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/69 (27%), Positives = 28/69 (40%) Frame = +1 Query: 355 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYD 534 G + PL ++ A Y +IGTPPQ+ + D +W C + +D Sbjct: 49 GGAVVPL-HWSGAHYVANFTIGTPPQAVSGIVDLSGELVWTQCAACRSSGCFKQELPVFD 107 Query: 535 SRKSKTYVA 561 S TY A Sbjct: 108 PSASNTYRA 116 >02_05_0554 + 29929860-29929959,29932944-29934220 Length = 458 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN--KYDSRKSKTYVANG 567 Y + +GTP + +V DTGSS W+ C ++C + ++ + S TY + G Sbjct: 122 YVTRMGLGTPATQYVMVVDTGSSLTWLQCSPC---LVSCHRQSGPVFNPKSSSTYASVG 177 >06_01_0772 + 5770502-5770619,5771035-5772335 Length = 472 Score = 29.9 bits (64), Expect = 1.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +1 Query: 376 SNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 S+ D + +S+G PP V DTGS+ WV + C Sbjct: 107 SSINDFLFLMAVSLGKPPVVNLVAIDTGSTLSWVQCQPC 145 >10_08_0773 + 20474642-20475835 Length = 397 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = +1 Query: 334 RLKYDVTGPSPEPLSNYLDAQYYGV--ISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 RL D T + + Y V +IGTPPQ + D +W +C Sbjct: 20 RLLADATPAGGSAVPIHWSRHLYNVANFTIGTPPQPASAIIDVAGELVWTQCSRC 74 >10_08_0772 + 20471748-20473004 Length = 418 Score = 29.1 bits (62), Expect = 3.2 Identities = 20/75 (26%), Positives = 28/75 (37%), Gaps = 5/75 (6%) Frame = +1 Query: 283 KTARTHFHEVGTELELL---RLKYDVTGPSPEPLSNYLDAQYYGV--ISIGTPPQSFKVV 447 +TA H++ LE RL D T + + Y V +IGTPPQ + Sbjct: 24 RTAAFRAHDLRRGLEQAMRGRLLADATPAGGSAVPIHWSRHLYNVANFTIGTPPQPASAI 83 Query: 448 FDTGSSNLWVPSKKC 492 D +W C Sbjct: 84 IDVAGELVWTQCSMC 98 >08_02_1095 - 24278295-24278741,24279066-24279307,24279647-24279731, 24279783-24280004 Length = 331 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 583 VSRTGCHSRRTSWTCGCRTCCAANKRCW 500 V+ G S R SW C R C N CW Sbjct: 167 VASRGRTSNRISWRCPGRRCAFRNDWCW 194 >04_04_1013 + 30109321-30110790 Length = 489 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +1 Query: 397 YYGVISIGTPPQSFK---VVFDTGSSNLWVPSKKCHYTNIACLL-HNKYDSRKSKTY 555 Y + IGTP V+FDTGS W + C TN + + +D KS+T+ Sbjct: 122 YLVQLRIGTPTDRISPRYVLFDTGSDLSWTQCEPC--TNCSSFTPYPPHDPSKSRTF 176 >04_04_1006 + 30048618-30050087 Length = 489 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Frame = +1 Query: 397 YYGVISIGTPPQSFK---VVFDTGSSNLWVPSKKCHYTNIACLL-HNKYDSRKSKTY 555 Y + IGTP V+FDTGS W + C TN + + +D KS+T+ Sbjct: 122 YLVQLRIGTPTDRISPRYVLFDTGSDLSWTQCEPC--TNCSSFTPYPPHDPSKSRTF 176 >03_02_0810 + 11429776-11429985,11430003-11430935 Length = 380 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 391 AQYYGVISIGTPPQSFKVVFDTGS 462 ++Y ++IGTPPQ ++ DTGS Sbjct: 34 SEYLVHLTIGTPPQPVQLTLDTGS 57 >01_07_0213 - 42028941-42029055,42029444-42029480,42029876-42030244, 42030332-42031201,42051574-42052891 Length = 902 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y +GTP Q+ V D + WVP C Sbjct: 102 YIARAGLGTPAQTLLVAIDPSNDAAWVPCSAC 133 >10_08_0778 + 20492822-20493920,20494605-20494648 Length = 380 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 382 YLDAQ--YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 YL +Q Y +IGTPPQ V D +W C Sbjct: 50 YLSSQGLYVANFTIGTPPQPVSAVVDLTGELVWTQCTPC 88 >11_01_0720 - 5943243-5944399,5946142-5946271 Length = 428 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 409 ISIGTPPQSFKVVFDTGSSNLWV--PSKKCHYTNIACLLHNK 528 + +GTP ++ V DTGSS WV CH TN L ++ Sbjct: 86 VGLGTPAKTQIVEIDTGSSTSWVFCECDGCH-TNPRTFLQSR 126 >11_01_0534 + 4227838-4228001,4229034-4229151,4229593-4229752, 4229901-4230027,4230899-4231037,4231119-4231301, 4231395-4231464,4231550-4231662 Length = 357 Score = 27.9 bits (59), Expect = 7.3 Identities = 22/73 (30%), Positives = 31/73 (42%), Gaps = 2/73 (2%) Frame = +1 Query: 382 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP-SKKCHYTNIACLLHNKYDSRKSKTY- 555 Y YY ++IG P + + + DTGS W+ C N + H Y K+K Sbjct: 52 YPTGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCN--KVPHPLYRPTKNKLVP 109 Query: 556 VANGTQFAIQYGS 594 AN A+ GS Sbjct: 110 CANSICTALHSGS 122 >10_08_0083 - 14715517-14715595,14716022-14716150,14716280-14716487, 14716789-14716852,14717727-14717768,14718175-14718279, 14718601-14718695,14718789-14718882 Length = 271 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 490 CHYTNIACLLHNKYDSRKSKTYVANG 567 C++ +AC H+ Y S +S TY NG Sbjct: 60 CNW-KVACFFHSHYKSGQSSTYQKNG 84 >10_08_0771 + 20463872-20465113 Length = 413 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +1 Query: 397 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 492 Y +IGTPPQ + D +W C Sbjct: 62 YVANFTIGTPPQPASAIVDVAGELVWTQCSAC 93 >07_03_1556 + 27692770-27694119 Length = 449 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 415 IGTPPQSFKVVFDTGSSNLWVPSKKC 492 +GTP Q + DT + W+P C Sbjct: 113 LGTPAQQLLLAVDTSNDAAWIPCSGC 138 >01_06_1068 - 34270420-34270581,34272185-34272238,34273741-34274070 Length = 181 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 568 CHSRRTSWTCG-CRTCCAANKRCWCS 494 C++R TS + G CR CC R W + Sbjct: 49 CYTRSTSRSIGRCRGCCRRRPRGWAA 74 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,582,305 Number of Sequences: 37544 Number of extensions: 385340 Number of successful extensions: 1070 Number of sequences better than 10.0: 86 Number of HSP's better than 10.0 without gapping: 1031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1065 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -