BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0630 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14655| Best HMM Match : Ketoacyl-synt_C (HMM E-Value=0) 31 0.85 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_47041| Best HMM Match : DUF1168 (HMM E-Value=0.41) 30 2.0 SB_33307| Best HMM Match : NAF1 (HMM E-Value=1.5e-18) 29 4.5 SB_45579| Best HMM Match : Calx-beta (HMM E-Value=1.8e-23) 29 4.5 SB_51437| Best HMM Match : RWD (HMM E-Value=1.3e-05) 28 7.9 SB_23666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) 28 7.9 SB_39243| Best HMM Match : HTH_7 (HMM E-Value=0.035) 28 7.9 >SB_14655| Best HMM Match : Ketoacyl-synt_C (HMM E-Value=0) Length = 2232 Score = 31.1 bits (67), Expect = 0.85 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = +1 Query: 163 YMIKVQIMNK*KRRNDYSSLRLL*VGGEGI----KTSQDLESMAFSIIHMRCDIWRSQLR 330 YM+++ + + R ++Y SLR E + K S+DL+ FS+ M + Q+ Sbjct: 2055 YMLRIAVRSLKMREDEYQSLRKKHSMSEMLDLLEKRSRDLDLSLFSLQAMWDSLLHDQVI 2114 Query: 331 LSTTHDE 351 S THDE Sbjct: 2115 SSKTHDE 2121 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 31.1 bits (67), Expect = 0.85 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Frame = +2 Query: 398 REIDVIINGTSYLTSPNITNSDIFDDSEATGIANETTVTDSND--VVKDNYTAPIKIIKR 571 R +D + T LT +T +D D ++T + + T+TD+ND V N A I + + Sbjct: 1616 RSLDREMKATYELT---VTATDRAGDPKSTSVEVDITITDANDNKPVFTNIPATILLSES 1672 Query: 572 DVTGTVVPNVQLSKENI 622 + GT V V + ++I Sbjct: 1673 TIPGTPVITVVATDQDI 1689 >SB_47041| Best HMM Match : DUF1168 (HMM E-Value=0.41) Length = 225 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +2 Query: 491 IANETTVTDSNDVVKDNYTAPIKIIKRDVTGTVV--PNVQLSKENIIIYSGNSTRRI 655 ++N+TT +ND DN A + I DVT TV NV+ + SGN +R+ Sbjct: 158 LSNDTT--PANDSKADNTQASVTEIDEDVTTTVASFKNVKTKLQQKDASSGNDNKRV 212 >SB_33307| Best HMM Match : NAF1 (HMM E-Value=1.5e-18) Length = 1085 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 416 INGTSYLTSPNITNSDIFDDSEATGIANETTVTDSNDVVKDNYTAPIKIIKRDVTGTV 589 +N TSY S + N D D + + ETT N V+ D+Y I+ D G++ Sbjct: 23 LNLTSYSDSED-ENDDTQDGNLQSANKQETTSQTDNAVISDSYVHEIENQPTDFNGSI 79 >SB_45579| Best HMM Match : Calx-beta (HMM E-Value=1.8e-23) Length = 253 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 473 DSEATGIANETTVTDSNDVVKDNYTAPIKI-IKRDVTGTVVPNVQLSKENIIIYS 634 D A G+ N TT+T ND + T + + I + T + +VQLS N +S Sbjct: 95 DQVALGLLNTTTITIGNDDQVEEDTGYVTVNITKTGTSDISLDVQLSTNNGTAFS 149 >SB_51437| Best HMM Match : RWD (HMM E-Value=1.3e-05) Length = 359 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 Query: 191 SKKDEMTILLYDYCELEERASKHLKTWKAWHLVLYICAAIFGVVNYVFL 337 S DE+ I+ D+ + R S++L+T +W L + A+F V ++FL Sbjct: 129 SSNDELLIVKLDH--MRSR-SRYLRTLNSWAQELDLLIAVFLVHKFIFL 174 >SB_23666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 533 KDNYTAPIKIIKRDVTGTVVPNVQLSKENI 622 K ++ P +++RD TG++ P+ L+ ENI Sbjct: 37 KAAFSPPTGVLRRDSTGSLSPDEDLTVENI 66 >SB_51904| Best HMM Match : CH (HMM E-Value=0.0058) Length = 1187 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/63 (22%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -3 Query: 192 LIHNLHFYHVKEVIMPAINTRPIVHIFIGFFLILVNTYQTRIPFPHTHGHR-VHSQTSLV 16 +IH +YH + ++P+ +T +H G++ + + H HR H +T ++ Sbjct: 162 IIHAHRYYHPRTRVLPSTHTGITIHAH-GYYHLRTQVLPSTHTGITIHAHRYYHPRTRVL 220 Query: 15 PNS 7 P++ Sbjct: 221 PST 223 >SB_39243| Best HMM Match : HTH_7 (HMM E-Value=0.035) Length = 694 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/56 (37%), Positives = 24/56 (42%) Frame = +2 Query: 440 SPNITNSDIFDDSEATGIANETTVTDSNDVVKDNYTAPIKIIKRDVTGTVVPNVQL 607 SPN D+FD V D+ D D+ TAP D TG VVP V L Sbjct: 604 SPNSAVRDVFDRD----------VLDNPDEYGDDQTAPPPDPDNDTTGVVVPPVNL 649 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,072,357 Number of Sequences: 59808 Number of extensions: 366577 Number of successful extensions: 1019 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -