Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0630
         (668 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g23550.1 68416.m02963 MATE efflux family protein similar to r...    29   3.7  

>At3g23550.1 68416.m02963 MATE efflux family protein similar to
           ripening regulated protein DDTFR18 [Lycopersicon
           esculentum] GI:12231296; contains Pfam profile: PF01554
           uncharacterized membrane protein family
          Length = 469

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +2

Query: 290 LYICAAIFGVVNYVFLQHTMKLIDNNCVLYPRQLEFREIDVIIN-GTSY 433
           LY+     G++ Y FLQ+ ++     C++ P  L F  + ++IN GT+Y
Sbjct: 153 LYMKYLAPGLLAYGFLQNILRFCQTQCIVTPLVL-FSFLPLVINIGTTY 200


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,108,248
Number of Sequences: 28952
Number of extensions: 244924
Number of successful extensions: 568
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 557
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 568
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1412971776
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)