BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0625 (560 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g30710.2 68417.m04353 expressed protein contains Pfam domain,... 33 0.17 At4g30710.1 68417.m04352 expressed protein contains Pfam domain,... 33 0.17 At5g02800.1 68418.m00222 protein kinase family protein contains ... 29 1.6 At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADNE... 28 3.7 At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa... 28 4.9 At2g31830.1 68415.m03887 endonuclease/exonuclease/phosphatase fa... 28 4.9 At4g28640.1 68417.m04094 auxin-responsive protein / indoleacetic... 27 6.5 At3g28790.1 68416.m03593 expressed protein 27 6.5 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 27 6.5 At1g05630.1 68414.m00584 endonuclease/exonuclease/phosphatase fa... 27 6.5 At3g28300.1 68416.m03535 integrin-related protein 14a identical ... 27 8.6 At3g28290.1 68416.m03533 integrin-related protein 14a identical ... 27 8.6 At3g23550.1 68416.m02963 MATE efflux family protein similar to r... 27 8.6 >At4g30710.2 68417.m04353 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 644 Score = 32.7 bits (71), Expect = 0.17 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -2 Query: 538 SRPSRPYRMGPMLASCTASTSEDGRA-QPSGSLSTSRGSCT*RPFTPSQVPMPQQMSSTS 362 SRP+ P R + +S + R PS LS SRG R +PS+ P + ++TS Sbjct: 320 SRPASPSRTSFLSSSSISRGMSTSRGVSPSRGLSPSRGLSPTRGLSPSRGLSPSRGTNTS 379 Query: 361 SVTRL*APHILTLKPSSL 308 R P + PS + Sbjct: 380 CFARPSTPPSRGISPSRI 397 >At4g30710.1 68417.m04352 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 644 Score = 32.7 bits (71), Expect = 0.17 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -2 Query: 538 SRPSRPYRMGPMLASCTASTSEDGRA-QPSGSLSTSRGSCT*RPFTPSQVPMPQQMSSTS 362 SRP+ P R + +S + R PS LS SRG R +PS+ P + ++TS Sbjct: 320 SRPASPSRTSFLSSSSISRGMSTSRGVSPSRGLSPSRGLSPTRGLSPSRGLSPSRGTNTS 379 Query: 361 SVTRL*APHILTLKPSSL 308 R P + PS + Sbjct: 380 CFARPSTPPSRGISPSRI 397 >At5g02800.1 68418.m00222 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 378 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -2 Query: 559 ESEAWGRSRPSRPYRMGPMLASCTASTSEDGRAQPSGSLSTSRGS 425 +S ++R + +++ + C+ STSE RA+ S S S S+GS Sbjct: 9 KSSGRNKTRRNGDHKLDRKSSDCSVSTSEKSRAKSSLSESKSKGS 53 >At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADNE-like protein ARI7 (ARI7) identical to ARIADNE-like protein ARI7 [Arabidopsis thaliana] GI:29125028; contains similarity to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster]; contains Pfam profile PF01485: IBR domain Length = 562 Score = 28.3 bits (60), Expect = 3.7 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 511 PFCTVCWAGY 540 PFCT CW GY Sbjct: 157 PFCTTCWTGY 166 >At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 3 WD-40 repeats (PF00400);similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56 (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens] Length = 1305 Score = 27.9 bits (59), Expect = 4.9 Identities = 20/79 (25%), Positives = 29/79 (36%), Gaps = 2/79 (2%) Frame = +2 Query: 11 RHEVCSLLYQSQFY*SLVTGVKPGSCRVKTATRAV*GLALSW--SNNGEDRFMSRGCFTL 184 RH C++L F + G G ++ L W NN + + + Sbjct: 480 RHHQCAVLCFCTFGERIYIGYVSGHIQIIDLEG---NLIAGWVAHNNAVIKMAAADGYIF 536 Query: 185 KAAARGGVRTWPAQSPSTL 241 A GG+R WP SP L Sbjct: 537 SLATHGGIRGWPVISPGPL 555 >At2g31830.1 68415.m03887 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 4 WD-40 repeats (PF00400);similar to SP:Q01968 Inositol polyphosphate 5-phosphatase OCRL-1 (EC 3.1.3.-)(Lowe's oculocerebrorenal syndrome protein) (SP:Q01968) [Homo sapiens] Length = 1144 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +2 Query: 122 LALSWSNNGED--RFMSRGCFTLKAAARGGVRTWPAQSPSTL 241 L SW ++ E + + G F A GGVR W SP L Sbjct: 518 LIASWVSHNEPVIKLAAGGGFIFSLATHGGVRGWYVTSPGPL 559 >At4g28640.1 68417.m04094 auxin-responsive protein / indoleacetic acid-induced protein 11 (IAA11) identical to SP|Q38829 Auxin-responsive protein IAA11 (Indoleacetic acid-induced protein 11) {Arabidopsis thaliana} Length = 246 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 532 PSRPYRMGPMLASCTASTSEDGRAQPSGSLSTSRGSCT 419 P R YRM M+ AS +ED + S +++ +R T Sbjct: 94 PIRTYRMNSMVNQAKASATEDPNLEISQAVNKNRSDST 131 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 511 GPMLASCTASTSEDGRAQPSGSLSTSRGS 425 G S T STS DG+A GS S S G+ Sbjct: 377 GSPSGSPTPSTSTDGKASSKGSASASAGA 405 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 27.5 bits (58), Expect = 6.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -1 Query: 410 VHSEPGADAPTDEQHIERHASLSAPHPHVEAFF 312 V S+P + +P H ++H + + P PH + F Sbjct: 49 VSSQPPSPSPHTHHHHKKHLTTTTPPPHEKHLF 81 >At1g05630.1 68414.m00584 endonuclease/exonuclease/phosphatase family protein similar to inositol 1,4,5-trisphosphate 5-phosphatase (GI:4688596) [Arabidopsis thaliana] Length = 861 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +2 Query: 122 LALSWSNNGED--RFMSRGCFTLKAAARGGVRTWPAQSPSTL 241 L SW ++ E + + G F A GGVR W SP L Sbjct: 509 LISSWVSHNEPVIKLAAGGGFIFSLATHGGVRGWYVTSPGPL 550 >At3g28300.1 68416.m03535 integrin-related protein 14a identical to integrin-related At14a protein GI:11994573 [Arabidopsis thaliana] Length = 385 Score = 27.1 bits (57), Expect = 8.6 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 324 NVRMWGAQRRVTL-DVLLICWGIGTWLGVNGLYVQLPLL 437 NV GA V + ++L+C G+G +GV GL + LPL+ Sbjct: 220 NVLFIGAFVAVAVGSMVLVCTGVGAGVGVAGL-LSLPLI 257 >At3g28290.1 68416.m03533 integrin-related protein 14a identical to At14a protein GI:11994573 [Arabidopsis thaliana] [Gene 230 (1), 33-40 (1999)], At14a protein [Arabidopsis thaliana] GI:4589123 Length = 385 Score = 27.1 bits (57), Expect = 8.6 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 324 NVRMWGAQRRVTL-DVLLICWGIGTWLGVNGLYVQLPLL 437 NV GA V + ++L+C G+G +GV GL + LPL+ Sbjct: 220 NVLFIGAFVAVAVGSMVLVCTGVGAGVGVAGL-LSLPLI 257 >At3g23550.1 68416.m02963 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile: PF01554 uncharacterized membrane protein family Length = 469 Score = 27.1 bits (57), Expect = 8.6 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 276 LTCGWEVAQPTTSVDGLWAGHVRTPPRAAAFSVK 175 LTCG A T + L AG+V+ +A + SVK Sbjct: 307 LTCGLSAATSTRVSNELGAGNVKGAKKATSVSVK 340 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,745,297 Number of Sequences: 28952 Number of extensions: 269073 Number of successful extensions: 705 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -