Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NRPG0624
         (662 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase prot...    23   2.0  
AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8 ...    23   3.4  
D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.         22   4.5  
AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly pro...    22   4.5  
AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly pro...    22   4.5  

>AY242387-1|AAO72539.2|  693|Apis mellifera prophenoloxidase
           protein.
          Length = 693

 Score = 23.4 bits (48), Expect = 2.0
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%)
 Frame = +3

Query: 339 TRTAPRRPSKTT*KDLARTATATEWSTA-MTTWRSTRREA--TGAPAN 473
           +RT P RPS T  KD+ R      +    +  WR    EA  TG+  N
Sbjct: 281 SRTWPFRPSGTVLKDINRQVDELNFDIQDLERWRDRIYEAIHTGSVIN 328


>AF080430-1|AAC28863.2|  208|Apis mellifera ribosomal protein S8
           protein.
          Length = 208

 Score = 22.6 bits (46), Expect = 3.4
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 209 LACIQR*PGKCSRD 168
           LACI   PG+C R+
Sbjct: 172 LACISSRPGQCGRE 185


>D79207-1|BAA23639.1|  432|Apis mellifera milk protein protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 164 VCLGCICQAISG 199
           VCLG +CQ  +G
Sbjct: 8   VCLGIVCQGTTG 19


>AF388203-1|AAM73637.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 164 VCLGCICQAISG 199
           VCLG +CQ  +G
Sbjct: 8   VCLGIVCQGTTG 19


>AF000633-1|AAC61895.1|  432|Apis mellifera major royal jelly
           protein MRJP1 protein.
          Length = 432

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = +2

Query: 164 VCLGCICQAISG 199
           VCLG +CQ  +G
Sbjct: 8   VCLGIVCQGTTG 19


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 196,346
Number of Sequences: 438
Number of extensions: 4400
Number of successful extensions: 20
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 19977660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)