BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0622 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 28 1.5 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 27 2.0 SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schi... 26 4.6 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 25 8.0 >SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1060 Score = 27.9 bits (59), Expect = 1.5 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +1 Query: 229 KKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSF 381 + + T L W + PT PF P+TS L + SSF Sbjct: 244 RARQTTRTRSNTLPWSPRVFGPTLGYNTPPFGYPPTTSSALPNASGSSSSF 294 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 27.5 bits (58), Expect = 2.0 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 530 ETVHRLINQLMAHNVPALVHYSLLNRFV*SVSECSMIRRWLYVLS 664 E+VH N+ +AHNV + + N + V E +R + Y +S Sbjct: 1834 ESVHAFNNRFVAHNVQVKWNNFIRNAVMSYVHEVERVRGFAYYMS 1878 >SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -1 Query: 105 FSSYSKVRCFKFKKIILHLRLPG--CTPSCRFLQPG 4 + S+S + F+F +IL + LPG C C ++ G Sbjct: 139 YGSFSDLGIFRFIMLILQIFLPGIVCIYLCEIIEKG 174 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 25.4 bits (53), Expect = 8.0 Identities = 7/31 (22%), Positives = 19/31 (61%) Frame = +3 Query: 300 EKKMFTICSKSKHKSWVKNIRIETIFIWRIR 392 +KK+ T+ + K + W+ + R I+++ ++ Sbjct: 1546 QKKLVTLAEQDKKRVWICSFRTNEIYLYGLK 1576 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,017,050 Number of Sequences: 5004 Number of extensions: 62800 Number of successful extensions: 174 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -