BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0621 (666 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47940.1 68416.m05227 DNAJ heat shock protein, putative simil... 28 4.9 At1g77400.1 68414.m09013 expressed protein 28 4.9 At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) fa... 27 8.5 >At3g47940.1 68416.m05227 DNAJ heat shock protein, putative similar to SP|O89114 DnaJ homolog subfamily B member 5 (Heat shock protein Hsp40-3) {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 350 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 140 PLRKPCYDFYFL*MIKFGQLPNNADGREATACRSEASCRIP 18 P ++ YD Y +K G++PN++ EA++ S +S R P Sbjct: 61 PQKRQIYDLYGEEGLKSGKIPNSSSS-EASSSSSSSSSRYP 100 >At1g77400.1 68414.m09013 expressed protein Length = 232 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 85 NFPTTPTAVKPPRVGPKPRAEFLQPGGS 2 +F TTP+ +KPPR P + F PG S Sbjct: 88 SFSTTPSKLKPPRT-PSSLSGFYSPGPS 114 >At4g28270.1 68417.m04049 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 193 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 516 VRSRARTR*SKEKLTDVLVFLTCVCVRCTTVF 611 VRSR R ++E L+ V +FL C C +F Sbjct: 162 VRSRRRAMQAEESLSRVYLFLLCFMFMCLFLF 193 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,680,637 Number of Sequences: 28952 Number of extensions: 194864 Number of successful extensions: 557 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -