BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0620 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22014| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-10) 33 0.20 SB_11563| Best HMM Match : SNF7 (HMM E-Value=0.28) 30 1.9 SB_43455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) 29 3.3 SB_24733| Best HMM Match : Shugoshin_C (HMM E-Value=4.2) 28 7.7 SB_29473| Best HMM Match : CASP_C (HMM E-Value=6.5) 28 7.7 SB_22759| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_22014| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-10) Length = 497 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +1 Query: 244 RDRTSEFISTVRSLQGRFLNKPTVRDDRKAAVLETYSQFMSMAK 375 RDRT+EF S V+S+Q R T+ D K +VLE +Q + K Sbjct: 41 RDRTTEFYSAVKSIQSRQSKLATMSKDFK-SVLEVRTQNLKQQK 83 >SB_11563| Best HMM Match : SNF7 (HMM E-Value=0.28) Length = 859 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 4/86 (4%) Frame = +1 Query: 64 RLLETETDS---YNKLDKKGVHYGESRPYENSSNSKSTLILKSSDQDVFKFLEEFVFEPV 234 R E ET++ KLD+ H +P+E+ S+ T S+D + K E + + Sbjct: 687 RRREAETEAKVLLQKLDRNETHTSRDQPWESVSSHSRTSSGSSNDMEFTKEEETRLKSYI 746 Query: 235 MASRDRTSEFISTVRSLQG-RFLNKP 309 R S STV L+ ++KP Sbjct: 747 QQLRSERSTIGSTVLELESIHGMDKP 772 >SB_43455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +1 Query: 250 RTSEFISTVRSLQGRFLNKPTVRDDRKAAVLETYSQFMSMAKVISKNITSTYTKLE 417 RT + V SL L+ P + D K V + S+F++ + ++ +STY K+E Sbjct: 168 RTIQKKKVVMSLSP-VLDNPKMERDLKILVRKELSEFLNSGPRVEESTSSTYNKIE 222 >SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) Length = 1011 Score = 29.1 bits (62), Expect = 3.3 Identities = 30/131 (22%), Positives = 57/131 (43%) Frame = +1 Query: 37 RRRNIGVTERLLETETDSYNKLDKKGVHYGESRPYENSSNSKSTLILKSSDQDVFKFLEE 216 R N T R+ E E D K+ +KG E E S K + ++ Q+ K +EE Sbjct: 784 REANEMKTSRIRELE-DRIEKMKRKGTEDSEKFMKEVSEKEKKLIAMEDKLQECNKTIEE 842 Query: 217 FVFEPVMASRDRTSEFISTVRSLQGRFLNKPTVRDDRKAAVLETYSQFMSMAKVISKNIT 396 +++ R+S+ T+ SL + L + + K A++ Q + + +++ I+ Sbjct: 843 ------LSANVRSSQ--ETIESL-SQMLRQEKNKFSFKEALVNELEQRLEQERKVTEQIS 893 Query: 397 STYTKLEKLAL 429 + E+ L Sbjct: 894 KALEEEEERTL 904 >SB_24733| Best HMM Match : Shugoshin_C (HMM E-Value=4.2) Length = 689 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +1 Query: 118 HYGESRPY--ENSSNSKSTLILKSSDQDVFKF 207 HY ++ PY E+ S+ STL ++ QD++K+ Sbjct: 16 HYHDTMPYYEESKSSILSTLYIEEGRQDIYKW 47 >SB_29473| Best HMM Match : CASP_C (HMM E-Value=6.5) Length = 389 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 31 LPRRRNIGVTERLLETETDSYNKLDKKGVHY 123 LPR +++G+ ERL + ++ +DK G Y Sbjct: 131 LPRHKDLGLLERLRHRKDGHHSNVDKNGNAY 161 >SB_22759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 27.9 bits (59), Expect = 7.7 Identities = 22/79 (27%), Positives = 41/79 (51%) Frame = +1 Query: 52 GVTERLLETETDSYNKLDKKGVHYGESRPYENSSNSKSTLILKSSDQDVFKFLEEFVFEP 231 GVT+ E ++ K+++K V+ + EN+ N K + ++ ++ K L+ + +P Sbjct: 138 GVTDIKRRKEMETETKINQKFVNTKKEDIKENNKNYKK----EFNNVELHKELQ--IVDP 191 Query: 232 VMASRDRTSEFISTVRSLQ 288 VMA R ++ RSLQ Sbjct: 192 VMARRIHPNDTRKIARSLQ 210 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,401,178 Number of Sequences: 59808 Number of extensions: 302062 Number of successful extensions: 690 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -