BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0619 (412 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0087 + 14476539-14476675,14478876-14479635,14479720-144798... 32 0.21 06_03_0259 - 18851809-18852561,18852659-18852895 29 1.4 12_02_1280 - 27517683-27517871,27517955-27518029,27518155-275183... 28 2.5 08_01_0500 + 4338111-4338195,4339910-4340042,4340116-4340187,434... 28 2.5 06_03_0257 + 18846638-18846850,18846934-18847689 28 3.3 03_02_0262 - 6944314-6944490,6944996-6945061,6945274-6945570 27 7.7 >09_04_0087 + 14476539-14476675,14478876-14479635,14479720-14479871, 14479958-14480024,14480632-14480831,14480915-14481068, 14481585-14481669,14481766-14481857,14482575-14482766, 14482867-14482992,14483072-14483125,14483494-14483550, 14484509-14484606,14484703-14485038,14485116-14485203, 14486891-14487016,14487082-14487138,14488054-14488133, 14488228-14488270,14488948-14489034,14489331-14489420, 14489996-14490054,14490141-14490231,14490330-14490495, 14490662-14490755,14491787-14492909 Length = 1537 Score = 31.9 bits (69), Expect = 0.21 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 264 DGDGVSTSIHNTPERPTKSERRSSATPPLDSETPE 368 +G+GVS+S +P+ S+ SSA PP PE Sbjct: 1473 EGEGVSSSEQKNTAKPSDSQGTSSARPPAPMRIPE 1507 >06_03_0259 - 18851809-18852561,18852659-18852895 Length = 329 Score = 29.1 bits (62), Expect = 1.4 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 110 PEARSDGGECLRLARLHGVDARCF 39 P SD GE LR+ HG+DAR F Sbjct: 173 PNPNSDLGELLRVFETHGLDARDF 196 >12_02_1280 - 27517683-27517871,27517955-27518029,27518155-27518318, 27518424-27518538,27518783-27519074,27519162-27519318, 27519438-27519510,27520309-27520377,27520471-27520694, 27520800-27520981,27521067-27522064,27522335-27522580 Length = 927 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 285 SIHNTPERPTKSERRSSATPPLDSETPEKILDRRLSKDK 401 S H+ + +SERRSS++ D+E ++ DR DK Sbjct: 295 SAHHIRDESRESERRSSSSRHKDNERRDRSKDRYKESDK 333 >08_01_0500 + 4338111-4338195,4339910-4340042,4340116-4340187, 4340524-4340587,4341383-4341459,4341586-4341657, 4341741-4341853,4341995-4342126,4342204-4342545, 4342628-4343022,4343293-4343603,4343967-4344066 Length = 631 Score = 28.3 bits (60), Expect = 2.5 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -1 Query: 361 VSLSKGGVAEERRSDFVGLSGVLWIDV 281 ++L+ G E D VGL+G+L++D+ Sbjct: 605 ITLASSGKGSELSDDAVGLTGILYLDI 631 >06_03_0257 + 18846638-18846850,18846934-18847689 Length = 322 Score = 27.9 bits (59), Expect = 3.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 110 PEARSDGGECLRLARLHGVDAR 45 P SD GE LR+ HG+DAR Sbjct: 165 PNPNSDLGELLRVFETHGLDAR 186 >03_02_0262 - 6944314-6944490,6944996-6945061,6945274-6945570 Length = 179 Score = 26.6 bits (56), Expect = 7.7 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 123 ESSSGESDDENQNDISDQQLQEMIR 197 + +GE DDEN +D D+ L +++ Sbjct: 77 DDDAGEEDDENDDDDEDRSLDLLVK 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,970,656 Number of Sequences: 37544 Number of extensions: 178569 Number of successful extensions: 671 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -