BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0617 (625 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51313| Best HMM Match : Pkinase (HMM E-Value=0.43) 83 1e-16 SB_30907| Best HMM Match : THAP (HMM E-Value=0.0033) 29 3.1 SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_39310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_54228| Best HMM Match : TBCC (HMM E-Value=7.8) 28 5.4 SB_49789| Best HMM Match : IncA (HMM E-Value=0.47) 28 5.4 SB_48610| Best HMM Match : DUF759 (HMM E-Value=4.6) 28 5.4 SB_27385| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_3233| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_56144| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_7898| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_52862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_45774| Best HMM Match : DUF1261 (HMM E-Value=4.4) 27 9.4 SB_10908| Best HMM Match : Cytochrom_B562 (HMM E-Value=3.4) 27 9.4 >SB_51313| Best HMM Match : Pkinase (HMM E-Value=0.43) Length = 456 Score = 83.4 bits (197), Expect = 1e-16 Identities = 35/91 (38%), Positives = 57/91 (62%) Frame = +1 Query: 73 LYNDLADDDGLFDAVGDYQFEVYRLMKSKLGNDWKNFEPYTNILWLHYTVDKMITALRYK 252 ++ DL++D+ +F GDYQF++YR M+ +DW ++PY+N+LWLHY DK++ Y Sbjct: 362 VFCDLSEDESMFTGQGDYQFDIYRKMRVHNRDDWAAYKPYSNVLWLHYLTDKILNNKEYP 421 Query: 253 RTNTKIHKHYIDKLKGIKNRILDYKSATDFV 345 N + K KLK ++ + DY+SA + V Sbjct: 422 NRNKTLEK----KLKCVQQTLTDYQSAQEVV 448 >SB_30907| Best HMM Match : THAP (HMM E-Value=0.0033) Length = 892 Score = 29.1 bits (62), Expect = 3.1 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 6/79 (7%) Frame = +1 Query: 139 YRLMKSKLGNDWKNFEPYTNILWLHYTVDKMI---TALRYKRTNTKIHKHYIDKL---KG 300 Y+ ++SK NDWK F+ Y N + + K I A R N + I++L K Sbjct: 327 YKAIRSKDVNDWKIFKKYRNFVNCQIKIAKQIYYDNAFRENEGNIRNTWKVINELTLRKT 386 Query: 301 IKNRILDYKSATDFVLTDN 357 + I + K D +TD+ Sbjct: 387 NNSTIKEVKLDDDHSITDS 405 >SB_5806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 418 Score = 29.1 bits (62), Expect = 3.1 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 13/130 (10%) Frame = +1 Query: 124 YQFEVYRL--MKSKLGNDWKNFEPYTNILWLHYTVDKMITALRYKRTNTKIHKHYIDKLK 297 +Q +V+++ ++SK NDWK F+ Y N + + K I Y NT + + I + Sbjct: 34 HQRDVFKIKAIRSKDVNDWKIFKKYRNFVNCQIKIAKQI----YYGNNTNLMNN-ISDIY 88 Query: 298 GIKNRILDYKSATD--FVLTDNEY*QNNEQI---------MLYHLILYNYTKWIH*EMFA 444 G+ I + T+ L D Y + ++I + YH ++Y Y K Sbjct: 89 GLTQLIKEATRITENKATLLDVFYTNHPDRIACSGVSHVGISYHSLVYAYRKL----SIV 144 Query: 445 RVTKMLLIMY 474 R+TK I+Y Sbjct: 145 RLTKNTTIIY 154 >SB_39310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 28.7 bits (61), Expect = 4.1 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -1 Query: 328 SCNREFYS*CPSICLCNACVSLYWFFCSVGPLSFYQQCNVATVCLYMVQSSS 173 +C RE Y+ +I CN V W S+G LS + VC+ ++ + S Sbjct: 68 NCEREQYTDVKAISPCNMDVYPLWSMTSLGVLSLLVITSNIAVCILVLCTRS 119 >SB_54228| Best HMM Match : TBCC (HMM E-Value=7.8) Length = 330 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL ++RL S N+ FYS Sbjct: 21 RILNELQCPLPKDRLFSWNKNFYS 44 >SB_49789| Best HMM Match : IncA (HMM E-Value=0.47) Length = 674 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL ++RL S N+ FYS Sbjct: 366 RILNELQCPLPKDRLFSWNKNFYS 389 >SB_48610| Best HMM Match : DUF759 (HMM E-Value=4.6) Length = 454 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL ++RL S N+ FYS Sbjct: 146 RILNELQCPLPKDRLFSWNKNFYS 169 >SB_27385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL ++RL S N+ FYS Sbjct: 366 RILNELQCPLPKDRLFSWNKNFYS 389 >SB_3233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL ++RL S N+ FYS Sbjct: 142 RILNELQCPLPKDRLFSWNKNFYS 165 >SB_56144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL ++RL S N+ FYS Sbjct: 196 RILNELQCPLPKDRLFSWNKNFYS 219 >SB_7898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL ++RL S N+ FYS Sbjct: 142 RILNELQCPLPKDRLFSWNKNFYS 165 >SB_805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1270 Score = 28.3 bits (60), Expect = 5.4 Identities = 25/92 (27%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = +1 Query: 82 DLADDDGLFDAVGDYQFEVYRLMKSKLGNDWK-NFEPYTNILWLHYTVDKMITALRYKRT 258 D A D L V DY ++ RL + D + + Y + LH T T L Sbjct: 1097 DYATDTRLHALVTDYAIDM-RLHVTDYATDTRLHVTDYATDMRLHVTDYATDTRLHVTDY 1155 Query: 259 NTKIHKHYIDKLKGIKNRILDYKSATDFVLTD 354 T + H D +K + DY + T +TD Sbjct: 1156 ATDMRLHVTDYATDMKLHVTDYATDTRLHVTD 1187 >SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -1 Query: 286 LCNACVSLYWFFCSVGPLSFYQQCNVATVCLYMVQSSSNHCPTC 155 +C C L W+ + P V T C + SSS CP C Sbjct: 430 ICLDCEGLLWYPVQIKPCGH----RVCTKCYTKLLSSSARCPGC 469 >SB_52862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 27.5 bits (58), Expect = 9.4 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 8/86 (9%) Frame = +1 Query: 124 YQFEVYRL--MKSKLGNDWKNFEPYTNILWLHYTVDKMI---TALRYKRTNTKIHKHYID 288 +Q +V+++ ++SK NDWK F+ Y N + + K I A R N + I+ Sbjct: 296 HQRDVFKIKAIRSKDVNDWKIFKKYRNFVNCQIKIAKQIYYDNAFRENEGNIRNTWKVIN 355 Query: 289 KL---KGIKNRILDYKSATDFVLTDN 357 +L K + I + K D +TD+ Sbjct: 356 ELISRKTNNSTIKEVKLDDDHSITDS 381 >SB_45774| Best HMM Match : DUF1261 (HMM E-Value=4.4) Length = 392 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL +++L S N+ FYS Sbjct: 34 RILSELQCPLPRDKLFSWNKNFYS 57 >SB_10908| Best HMM Match : Cytochrom_B562 (HMM E-Value=3.4) Length = 389 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 376 RCFVNIRCPLKQNRLHSCNREFYS 305 R ++CPL +++L S N+ FYS Sbjct: 265 RILNELQCPLPEDKLFSWNKNFYS 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,011,673 Number of Sequences: 59808 Number of extensions: 321768 Number of successful extensions: 758 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -