BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0615 (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF099919-12|AAC68797.1| 63|Caenorhabditis elegans Hypothetical... 88 6e-18 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 27 9.2 >AF099919-12|AAC68797.1| 63|Caenorhabditis elegans Hypothetical protein F40G9.2 protein. Length = 63 Score = 87.8 bits (208), Expect = 6e-18 Identities = 37/45 (82%), Positives = 38/45 (84%) Frame = +3 Query: 225 KLKPCCACPETKRARDACIIKNGEENCGPLIEEHKACMRKMGFNI 359 KLK CCACPETKR RDACII+NGEE CG LIE HKACMR GFNI Sbjct: 19 KLKACCACPETKRVRDACIIENGEEKCGKLIEAHKACMRAAGFNI 63 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -1 Query: 286 FIMHASRALFVSGQAQQGFSLGFSTFSGAGPS 191 FI HA AL SG +Q L F+GA PS Sbjct: 5401 FIQHAYLALENSGYVKQKHELRCGVFAGAEPS 5432 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,491,229 Number of Sequences: 27780 Number of extensions: 254233 Number of successful extensions: 594 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 593 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -