BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0615 (673 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15352.1 68416.m01943 cytochrome c oxidase copper chaperone-r... 69 4e-12 At1g53030.1 68414.m06003 cytochrome c oxidase copper chaperone f... 63 1e-10 At2g21340.2 68415.m02540 enhanced disease susceptibility protein... 29 3.7 At2g21340.1 68415.m02539 enhanced disease susceptibility protein... 29 3.7 At1g56210.1 68414.m06460 copper chaperone (CCH)-related low simi... 29 3.7 At4g23070.1 68417.m03326 rhomboid family protein contains PFAM d... 28 6.5 >At3g15352.1 68416.m01943 cytochrome c oxidase copper chaperone-related contains similarity to cytochrome c oxidase copper chaperone [Mus musculus] SWISS-PROT:P56394 Length = 74 Score = 68.5 bits (160), Expect = 4e-12 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +3 Query: 219 KPKLKPCCACPETKRARDACIIKNGEENCGPLIEEHKACMRKMGFNI 359 KPK + CCACP+TK+ RD CI+++GE C IE HK C+R GFN+ Sbjct: 28 KPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHKICLRAEGFNV 74 >At1g53030.1 68414.m06003 cytochrome c oxidase copper chaperone family protein contains Pfam domian, PF05051: Cytochrome C oxidase copper chaperone (COX17) Length = 72 Score = 63.3 bits (147), Expect = 1e-10 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +3 Query: 219 KPKLKPCCACPETKRARDACIIKNGEENCGPLIEEHKACMRKMGFNI 359 KPK + CCACP+TK+ RD CI+++GE C IE H C+R GF + Sbjct: 26 KPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHILCLRSEGFKV 72 >At2g21340.2 68415.m02540 enhanced disease susceptibility protein, putative / salicylic acid induction deficient protein, putative similar to enhanced disease susceptibility 5 [Arabidopsis thaliana] GI:16589070 Length = 552 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 223 GFSTFSGAGPSKTLTSTALALAFPIFQEVFSHMMQFNLLFF 101 G+S FS PS + T LA P+F + S ++ + LL + Sbjct: 315 GYSAFSFCVPSPSELLTIFGLAAPVFITMMSKVLFYTLLVY 355 >At2g21340.1 68415.m02539 enhanced disease susceptibility protein, putative / salicylic acid induction deficient protein, putative similar to enhanced disease susceptibility 5 [Arabidopsis thaliana] GI:16589070 Length = 555 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 223 GFSTFSGAGPSKTLTSTALALAFPIFQEVFSHMMQFNLLFF 101 G+S FS PS + T LA P+F + S ++ + LL + Sbjct: 318 GYSAFSFCVPSPSELLTIFGLAAPVFITMMSKVLFYTLLVY 358 >At1g56210.1 68414.m06460 copper chaperone (CCH)-related low similarity to copper homeostasis factor [GI:3168840][PMID:9701579] and farnesylated proteins ATFP3 [GI:4097547] and GMFP7 [Glycine max][GI:4097573]; contains PF00403 Heavy-metal-associated domain Length = 364 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +3 Query: 207 ENVEKPKLKPCCACPETKRARDACIIKNGEENCGPLIEEHKACMRK 344 +N EKP C K + C+ +G E GP+ EE K +++ Sbjct: 145 DNPEKPGSGECDKPESEKPVDEKCLSGDGGETSGPVKEEKKDVLKE 190 >At4g23070.1 68417.m03326 rhomboid family protein contains PFAM domain PF01694, Rhomboid family Length = 313 Score = 27.9 bits (59), Expect = 6.5 Identities = 22/96 (22%), Positives = 35/96 (36%), Gaps = 1/96 (1%) Frame = -1 Query: 481 MWIINLFFFFHIGTDLLTNKQCCRRYFVANNTLIENSV*L*ILNPIFLIQALCSSISGPQ 302 +W + + H G L CC Y +E + I+L+ C SI Sbjct: 104 VWRLLTCMWLHAGVIHLLANMCCVAYI---GVRLEQQFGFVRVGTIYLVSGFCGSILSCL 160 Query: 301 FSSPFFIMHASRALF-VSGQAQQGFSLGFSTFSGAG 197 F + AS ALF + G + ++T+ G Sbjct: 161 FLEDAISVGASSALFGLLGAMLSELLINWTTYDNKG 196 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,363,120 Number of Sequences: 28952 Number of extensions: 220214 Number of successful extensions: 448 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -