BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0614 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase |Schi... 42 8e-05 SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase G... 37 0.003 SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosac... 27 1.7 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 26 5.3 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 25 7.0 SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|ch... 25 7.0 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 25 7.0 SPCC24B10.19c |||sequence orphan|Schizosaccharomyces pombe|chr 3... 25 7.0 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 25 9.3 SPBC18E5.10 |||iron sulfur cluster assembly protein |Schizosacch... 25 9.3 >SPAC4D7.02c |||glycerophosphoryl diester phosphodiesterase |Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 41.9 bits (94), Expect = 8e-05 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 8/61 (13%) Frame = +3 Query: 138 PLIIAHRGAS-GYV-------PEHTLGSYALSITMGADYIEPDLVMTKDGVLVARHDNEL 293 PL+IAHRG YV PE+T+ ++ ++ GAD +E D+ +TKD V+ HD L Sbjct: 32 PLVIAHRGKCLTYVYRYKAKYPENTILAFQQAVKAGADCVETDVRLTKDEVVCILHDRNL 91 Query: 294 S 296 + Sbjct: 92 N 92 >SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase Gde1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 36.7 bits (81), Expect = 0.003 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = +3 Query: 144 IIAHRGASGYVP--------EHTLGSYALSITMGADYIEPDLVMTKDGVLVARHD 284 +I HRG P E+TL S+ + +GA Y+E D+ MTKD V V HD Sbjct: 749 VIGHRGLGKNQPDRLSLQLGENTLQSFIKAADLGASYVELDVQMTKDMVPVVYHD 803 >SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosaccharomyces pombe|chr 3|||Manual Length = 1140 Score = 27.5 bits (58), Expect = 1.7 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 387 EDFTLAEIKTLRARERIPDIRAGNARMDGTFTIPTFQEIISLAKG 521 ++F AE+K A+E + I + +DG I + +E+I AKG Sbjct: 343 KEFQHAEVKLSEAKENLESIVTNQSDIDG--KISSKEEVIGRAKG 385 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 25.8 bits (54), Expect = 5.3 Identities = 20/58 (34%), Positives = 27/58 (46%) Frame = -3 Query: 406 SASVKSSVNQPVIADPSTV*VRLRVANSIRLATSVVKLSSLSCRATSTPSFVITRSGS 233 +ASV S V A ST V +++I A S LSS + +ST + T S S Sbjct: 1084 TASVTGSPTSSVTAVSSTSSVEGTASSTIAAAASAATLSSDAASGSSTVTSSATASSS 1141 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 25.4 bits (53), Expect = 7.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 27 IFGLLVLSFSTVGITFGIPVNENLDF 104 I LL + FS V + F +PV+ ++DF Sbjct: 711 IHTLLKVIFSVVPLPFDVPVDNSVDF 736 >SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 684 Score = 25.4 bits (53), Expect = 7.0 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 323 NTTCDVGCQTQFVVMSGHKYPVFR 252 +T CDV + FVV +YP R Sbjct: 53 DTVCDVSSNSTFVVKCNRQYPCTR 76 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 25.4 bits (53), Expect = 7.0 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 584 KMCAMFYFWINSNSSFLTFLQTFRQTNDFLKRRNREGAIHTCVASSD 444 ++CA +S+SSF T ++ Q ND L + G + T V+ D Sbjct: 1319 RLCAKSDDETSSSSSFATDIEMCEQCNDPLSSKKNSGIV-TSVSFDD 1364 >SPCC24B10.19c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 455 Score = 25.4 bits (53), Expect = 7.0 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +2 Query: 410 KNVTS*RTHTRYQSWQRTYGWHLHDSYVSR-NH*SGERSAKKSKKNYWNLSRNK 568 K V R T +WQ+ W + + +S SG K+K NLSRNK Sbjct: 400 KRVKIKRIRTLLDTWQQE--WRILNKAISNAESNSGRGQNSKTKTTSVNLSRNK 451 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 25.0 bits (52), Expect = 9.3 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -1 Query: 321 YDLRRRLSNSVRCHVGPQVPRLSS--LPDQVRCNQLPWL 211 YD R+L+ S+R + PRLSS LP Q+R L W+ Sbjct: 193 YDCARKLAKSLRFANVSRDPRLSSELLPFQMRV--LEWM 229 >SPBC18E5.10 |||iron sulfur cluster assembly protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.0 bits (52), Expect = 9.3 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 Query: 360 GSAITGWFTEDFTLAEIKTLRARERIPDIRAGNARMDGTFTIPT 491 GS ITG E+ L I++L+ +PDI N G F +PT Sbjct: 200 GSYITG---EESAL--IQSLQGEFPVPDIPINNTITSGLFGLPT 238 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,802,295 Number of Sequences: 5004 Number of extensions: 59750 Number of successful extensions: 211 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 210 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -