BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0614 (642 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 4.4 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 5.8 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 393 FTLAEIKTLRARERIPDIRAGNARMDGTFTIPTFQE 500 + + EIK RA +PD DGT I + Q+ Sbjct: 545 YPIEEIKWERANRELPDDLRQKVLPDGTLVITSVQK 580 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 393 FTLAEIKTLRARERIPDIRAGNARMDGTFTIPTFQE 500 + + EIK RA +PD DGT I + Q+ Sbjct: 545 YPIEEIKWERANRELPDDLRQKVLPDGTLVITSVQK 580 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 4.4 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = -2 Query: 497 LKRRNREGAIHTCVAS--SDIWYAFSSS*RFYFGQCKIFREPTGDSRSVHCLSPVACSEF 324 LK R R +H +S + W +S + CK+ R P G + + L + F Sbjct: 67 LKLRIRCSDVHHFESSFNAQSWQRLTSLHELHVHGCKVLRIPEGAFQPLLELKKLTVQTF 126 Query: 323 NT 318 N+ Sbjct: 127 NS 128 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 639 RFYGVCSQQAPPLPDL 592 RF G C PPLP L Sbjct: 429 RFGGSCLIHGPPLPPL 444 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 639 RFYGVCSQQAPPLPDL 592 RF G C PPLP L Sbjct: 429 RFGGSCLIHGPPLPPL 444 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,635 Number of Sequences: 438 Number of extensions: 4355 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -