BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0608 (634 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U13019-11|AAC24449.1| 445|Caenorhabditis elegans Hypothetical p... 30 1.2 Z82267-6|CAB05189.2| 133|Caenorhabditis elegans Hypothetical pr... 28 4.8 Z70306-3|CAA94325.1| 318|Caenorhabditis elegans Hypothetical pr... 27 8.4 >U13019-11|AAC24449.1| 445|Caenorhabditis elegans Hypothetical protein T12A2.1 protein. Length = 445 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 326 NGKITQKGSIEEFEELLSA-GKFSEHIVINLSDSQLIIPGFIDCHIH 463 NGK + G++ E L G E++ I S+ + IPGF+D H H Sbjct: 49 NGKFSYIGNLNGAENKLKGEGVEMENLKIIDSNGGIAIPGFVDGHSH 95 >Z82267-6|CAB05189.2| 133|Caenorhabditis elegans Hypothetical protein F38C2.2 protein. Length = 133 Score = 28.3 bits (60), Expect = 4.8 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +2 Query: 266 YAHSDNKRQLSVCFGFLTIENGKITQKGSIEEFEELLSAGKFSEHIVINLSDS 424 YAH + R+LS L +N I Q +IEE L+S K + NL+ S Sbjct: 75 YAHGGSVRKLSKIATLLLAKNHIIMQAKAIEELSILVSQLKRKSENLENLNKS 127 >Z70306-3|CAA94325.1| 318|Caenorhabditis elegans Hypothetical protein C06G8.4 protein. Length = 318 Score = 27.5 bits (58), Expect = 8.4 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 346 FLCYLSIFNSQKPETYRKLSFVIGMSVSTNKG 251 FLCYL+IF Q P+ R S V+ TN G Sbjct: 25 FLCYLAIF--QSPKAIRTYSLVLINITLTNVG 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,559,320 Number of Sequences: 27780 Number of extensions: 274653 Number of successful extensions: 602 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 590 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1395683256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -