BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0603 (695 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I462 Cluster: Putative uncharacterized protein PFE019... 33 8.8 UniRef50_Q4L5U8 Cluster: Succinyl-CoA synthetase beta chain; n=2... 33 8.8 >UniRef50_Q8I462 Cluster: Putative uncharacterized protein PFE0190c; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFE0190c - Plasmodium falciparum (isolate 3D7) Length = 662 Score = 32.7 bits (71), Expect = 8.8 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 122 LITLNKINK*ISNMKFHTMTSMFV*IQNKKYQYDI 226 ++ LNKINK N +F T T +F +QNK ++ I Sbjct: 539 IVPLNKINKESGNFEFFTGTHLFSSLQNKSLKHKI 573 >UniRef50_Q4L5U8 Cluster: Succinyl-CoA synthetase beta chain; n=21; Bacteria|Rep: Succinyl-CoA synthetase beta chain - Staphylococcus haemolyticus (strain JCSC1435) Length = 388 Score = 32.7 bits (71), Expect = 8.8 Identities = 14/37 (37%), Positives = 26/37 (70%), Gaps = 4/37 (10%) Frame = +1 Query: 376 VTFTIDFPTQAL----KFLVKIYNIFLKKNFSI*EIS 474 + F I+ P +++ KFL+ +YN+F++K+ SI EI+ Sbjct: 163 IAFNINIPKESINKAAKFLISLYNVFIEKDCSIVEIN 199 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 556,118,756 Number of Sequences: 1657284 Number of extensions: 10314321 Number of successful extensions: 20997 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20994 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -