BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0603 (695 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 22 5.5 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 22 5.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 7.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 9.6 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 405 SVKIFSKNLQHFLKKKFFHLRNFN*WFYQFI 497 S+K +N H+++ F L N FY F+ Sbjct: 149 SIKPKERNSNHWVRSGLFALITGNVLFYPFL 179 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 405 SVKIFSKNLQHFLKKKFFHLRNFN*WFYQFI 497 S+K +N H+++ F L N FY F+ Sbjct: 105 SIKPKERNSNHWVRSGLFALITGNVLFYPFL 135 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 7.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 571 DSTIQERMQLSSIKR 615 D+TIQE + L IKR Sbjct: 322 DATIQEMLDLGVIKR 336 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/29 (24%), Positives = 17/29 (58%) Frame = -1 Query: 152 FIYLFYLELSAKQILLSGVYFVLSISMIL 66 F Y +Y K + + ++F++ +S++L Sbjct: 272 FCYCYYNSKMTKDGVYNTLFFIVYVSLLL 300 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,558 Number of Sequences: 336 Number of extensions: 3258 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -