BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0603 (695 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113222-1|AAM29227.1| 677|Drosophila melanogaster AT09218p pro... 29 6.0 AE013599-3456|AAM71116.1| 422|Drosophila melanogaster CG30275-P... 29 6.0 AE013599-3455|AAO41345.1| 677|Drosophila melanogaster CG30275-P... 29 6.0 AE013599-3454|AAM71115.1| 1114|Drosophila melanogaster CG30275-P... 29 6.0 AE013599-3453|AAM71114.1| 1127|Drosophila melanogaster CG30275-P... 29 6.0 >AY113222-1|AAM29227.1| 677|Drosophila melanogaster AT09218p protein. Length = 677 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 381 CNVCT*SIILNSTYIAFYKVFRVLESNERSYCVFIY 274 CN+ + LN ++ FYKV +LE R+Y V +Y Sbjct: 316 CNLVEINFRLNK-FLLFYKVRALLEDMPRTYLVLVY 350 >AE013599-3456|AAM71116.1| 422|Drosophila melanogaster CG30275-PB, isoform B protein. Length = 422 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 381 CNVCT*SIILNSTYIAFYKVFRVLESNERSYCVFIY 274 CN+ + LN ++ FYKV +LE R+Y V +Y Sbjct: 61 CNLVEINFRLNK-FLLFYKVRALLEDMPRTYLVLVY 95 >AE013599-3455|AAO41345.1| 677|Drosophila melanogaster CG30275-PD, isoform D protein. Length = 677 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 381 CNVCT*SIILNSTYIAFYKVFRVLESNERSYCVFIY 274 CN+ + LN ++ FYKV +LE R+Y V +Y Sbjct: 316 CNLVEINFRLNK-FLLFYKVRALLEDMPRTYLVLVY 350 >AE013599-3454|AAM71115.1| 1114|Drosophila melanogaster CG30275-PC, isoform C protein. Length = 1114 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 381 CNVCT*SIILNSTYIAFYKVFRVLESNERSYCVFIY 274 CN+ + LN ++ FYKV +LE R+Y V +Y Sbjct: 753 CNLVEINFRLNK-FLLFYKVRALLEDMPRTYLVLVY 787 >AE013599-3453|AAM71114.1| 1127|Drosophila melanogaster CG30275-PA, isoform A protein. Length = 1127 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 381 CNVCT*SIILNSTYIAFYKVFRVLESNERSYCVFIY 274 CN+ + LN ++ FYKV +LE R+Y V +Y Sbjct: 766 CNLVEINFRLNK-FLLFYKVRALLEDMPRTYLVLVY 800 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,127,831 Number of Sequences: 53049 Number of extensions: 431349 Number of successful extensions: 691 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3046624548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -