BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0601 (682 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.9 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 23 8.9 AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-l... 23 8.9 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 8.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 422 HHRASDFFDAIFILHFC 472 HHR++D DA+ L FC Sbjct: 531 HHRSNDTTDALCGLIFC 547 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 23.0 bits (47), Expect = 8.9 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +2 Query: 38 FNKLPTFDQYVSPRKIYQAAANVKNLKALPTDAQLLNLYAHFK 166 F L T QYV K+ A + L L +LL +YA K Sbjct: 138 FGNLVTCPQYVRSTKLQATQAALDCLVMLRYPEKLLKVYASGK 180 >AF457554-1|AAL68784.1| 269|Anopheles gambiae salivary gland 1-like 3 protein protein. Length = 269 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 167 QATVGDADPANRPGLLDLK 223 +ATVG AD A R L D+K Sbjct: 226 EATVGQADAAVRQALDDVK 244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,460 Number of Sequences: 2352 Number of extensions: 13268 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -