BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0594 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|... 26 4.0 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 7.1 >SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 443 Score = 26.2 bits (55), Expect = 4.0 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +1 Query: 10 GGARMKTVYCYLKIFKNARRHIIPIAXLKKKYLTF 114 G AR+K + +++++ RH +PI + + F Sbjct: 326 GHARIKNIELFIRLYSQMYRHCVPIIEIYDTSIKF 360 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.4 bits (53), Expect = 7.1 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -3 Query: 414 LVSCRIQSGEQLVLNVSGIITWTAMITLPHRG*HVPYFCYSYKK*GQFTN 265 ++S + Q+ QL LNV I+ + I + HRG +VP S K G N Sbjct: 1864 VISSQSQNISQL-LNVYDFISSHSDIFIEHRGRYVPILIDSLYKFGAIPN 1912 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,784,193 Number of Sequences: 5004 Number of extensions: 59550 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -