BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0594 (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114,446... 29 3.2 10_02_0105 - 5345149-5347833 27 9.7 03_06_0057 - 31326067-31326097,31326453-31326517,31326960-313270... 27 9.7 >03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114, 4469273-4469314,4469496-4469572,4469671-4469755, 4469818-4469901,4469988-4470089,4470181-4470279, 4470794-4470919 Length = 1193 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 381 IVHQIESDTIPGNTSWPPEWLRCDF 455 +V I+ D T WP EWL DF Sbjct: 954 LVESIDEDAGKEGTCWPREWLSADF 978 >10_02_0105 - 5345149-5347833 Length = 894 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/66 (24%), Positives = 32/66 (48%) Frame = +1 Query: 445 GVTSFNFSNPTVLYLMGFSESTRGVSTTTLRNAYLNSGHYNFIAVDWSRLIVFPWYVTAV 624 G F+F+ +L ++ F S + T TL H ++ ++ S + +FP Y+ + Sbjct: 561 GKRLFSFNGLHLLRVLHFCSSLK---TCTLPEEINKLVHLRYLGLEGSTVFMFPSYMKGL 617 Query: 625 RNTRYM 642 RN + + Sbjct: 618 RNLQIL 623 >03_06_0057 - 31326067-31326097,31326453-31326517,31326960-31327032, 31327134-31327185,31327320-31327366,31327694-31327728 Length = 100 Score = 27.5 bits (58), Expect = 9.7 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 304 IWYMSAPVGECDHCC 348 +WY + P CD+CC Sbjct: 40 LWYSARPCSVCDYCC 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,745,101 Number of Sequences: 37544 Number of extensions: 370891 Number of successful extensions: 653 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -