BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0594 (644 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26408| Best HMM Match : Lipase (HMM E-Value=0) 44 8e-05 SB_2178| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_21242| Best HMM Match : Prog_receptor (HMM E-Value=0.79) 30 1.4 SB_20479| Best HMM Match : Collagen (HMM E-Value=1) 29 4.3 SB_38947| Best HMM Match : CD36 (HMM E-Value=1.4e-15) 28 5.7 SB_51251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 >SB_26408| Best HMM Match : Lipase (HMM E-Value=0) Length = 714 Score = 44.4 bits (100), Expect = 8e-05 Identities = 34/100 (34%), Positives = 47/100 (47%), Gaps = 8/100 (8%) Frame = +1 Query: 361 STDIQYQLFTRLNPTRYQVIPVGLQNGLGVTSFNFSNPTVLYLMGFSESTRGVSTT---- 528 S Q+ L+TR +P +YQ + + T FN S TV+ + GF+ T S Sbjct: 70 SIHTQFMLYTRESPVQYQQLYEDMDITRD-THFNASRRTVIIIHGFAGFTTLTSIRHEVN 128 Query: 529 ----TLRNAYLNSGHYNFIAVDWSRLIVFPWYVTAVRNTR 636 ++N L G +N I VDW R FP + AV NTR Sbjct: 129 WWGFPMKNELLWEGDFNVIIVDWMRGAWFP-FTRAVANTR 167 >SB_2178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 532 LRNAYLNSGHYNFIAVDWSRLIVFPWYVTAVRNTR 636 ++N L G +N I VDW R FP + AV NTR Sbjct: 19 MKNELLWEGDFNVIIVDWMRGAWFP-FTRAVANTR 52 >SB_21242| Best HMM Match : Prog_receptor (HMM E-Value=0.79) Length = 1091 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 204 GDFSSENTAHFTGTGYSSTD-YSGHIRNLNS 115 GD+SS + T GY S D Y+ H+R+L+S Sbjct: 553 GDYSSMDDQRLTDDGYYSKDSYANHLRSLSS 583 >SB_20479| Best HMM Match : Collagen (HMM E-Value=1) Length = 1214 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +1 Query: 289 IGIAEIWYMSAPVGECD-HCCPRDDSTDIQYQLFTRLNPTRYQVIPVGLQN 438 I +A IW +S+ G C+ H RDD ++ + + N QV PVG++N Sbjct: 425 IAVAFIWLLSSLKGNCEIHI--RDD----EFYPYVQFNLNDPQVSPVGIEN 469 >SB_38947| Best HMM Match : CD36 (HMM E-Value=1.4e-15) Length = 314 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +1 Query: 307 WYMSAPVGECDHCCPRDDS---TDIQYQLFTRLNPTRYQVIPVGL 432 WY+ P C C P DS +I Y + T + + +++ VG+ Sbjct: 118 WYVFTPELSCSGCDPEADSVTTVNIAYAIMTEVAKSYSRIVRVGI 162 >SB_51251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 27.9 bits (59), Expect = 7.5 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +1 Query: 28 TVYCYLKIFKNARRH 72 T+YCY+ IF++ R+H Sbjct: 198 TIYCYVSIFRSVRQH 212 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,814,483 Number of Sequences: 59808 Number of extensions: 447364 Number of successful extensions: 944 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 943 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -