BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0592 (671 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114,446... 29 3.4 08_02_1333 + 26215545-26215759,26217315-26217372,26218263-262183... 28 5.9 >03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114, 4469273-4469314,4469496-4469572,4469671-4469755, 4469818-4469901,4469988-4470089,4470181-4470279, 4470794-4470919 Length = 1193 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 341 IVHQIESDTIPGNTSWPPEWLRCDF 415 +V I+ D T WP EWL DF Sbjct: 954 LVESIDEDAGKEGTCWPREWLSADF 978 >08_02_1333 + 26215545-26215759,26217315-26217372,26218263-26218342, 26218606-26218639,26218756-26218896 Length = 175 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = +3 Query: 534 AVDWSRLIVFPWYVTAVRNTRYMGKRLANFVEYLD---RAGVRASSLHV 671 A++W L+ W + + TR AN +Y+D +A V SLH+ Sbjct: 51 ALEWLLLLCIHWIASPSKGTRRRYMHQANMHKYVDNKGKANVAIYSLHI 99 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,882,629 Number of Sequences: 37544 Number of extensions: 402629 Number of successful extensions: 772 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 772 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -