BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0584 (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0170 - 23268714-23268950,23269040-23269303,23269379-232694... 29 2.7 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 28 6.2 >04_04_0170 - 23268714-23268950,23269040-23269303,23269379-23269494, 23269574-23269792,23269961-23270080,23270170-23270283, 23271870-23271946,23272527-23272657 Length = 425 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 242 WQVLVAVIII*KERLSAMRVVQLLENTIHTNLVSVSPYCIFNNICIYVF 388 W V V I+ + + +R V L + H NLVS+ YC C V+ Sbjct: 159 WPVAVKHIVKNEHAETFLREVTSLSHVRHPNLVSLRGYCDGQEECFLVY 207 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 302 VQLLENTIHTNLVSVSPYCIFNNICIYVFFF 394 V+++ H +LVS+ YCI NN + V+ F Sbjct: 347 VEIISRVHHRHLVSLVGYCISNNQRLLVYDF 377 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,843,553 Number of Sequences: 37544 Number of extensions: 157881 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -