BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NRPG0583 (537 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1162 + 28093749-28093851,28093939-28093997,28094691-280947... 28 5.4 06_03_1104 + 27623632-27623795,27624052-27624175,27624316-276248... 28 5.4 04_03_1044 - 21965237-21965341,21966130-21966300,21966414-219665... 27 7.2 04_04_1346 + 32798825-32798900,32799027-32799070,32799163-327992... 27 9.5 04_04_0214 - 23674270-23676858,23677574-23680843,23680941-236811... 27 9.5 >06_03_1162 + 28093749-28093851,28093939-28093997,28094691-28094766, 28094848-28094919,28095023-28095110,28095230-28095485, 28095583-28095698,28096064-28096127,28096252-28096354, 28096446-28096554,28097048-28097234 Length = 410 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +2 Query: 23 FYSVVIQFGGNI*LNNNGPRRWNVLCKVPHVLLQSPVCHYGIDH 154 F+S+ Q+ G + GP W+ L K P ++ +DH Sbjct: 6 FWSIYYQYEGAVNEGQRGPTIWDTLTKRPGRVIDFSNADVAVDH 49 >06_03_1104 + 27623632-27623795,27624052-27624175,27624316-27624832, 27624943-27625073,27625161-27625567,27625690-27625963, 27626195-27626814,27627424-27627859 Length = 890 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -2 Query: 488 DINSLLDVLVYRILSNGSVQVAHNRIFQVRMLHVTSDAHSQFSHEYDQEEY*KRYYH 318 D N L D+ + +LSNG AH I VR + A S S +E+ + +YH Sbjct: 614 DDNELADLEL--LLSNGESLKAHTAIISVRCPKLLPSAKSLGSDGKITDEWGRSFYH 668 >04_03_1044 - 21965237-21965341,21966130-21966300,21966414-21966564, 21968768-21969348 Length = 335 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 369 AVGIAGYMKHTDLEDSVMRNLNASITQYPVDKNVQKTIDIIQTDLQCCG 515 AV +AG + T L V R + +++ Y V+ V+ +ID+ + G Sbjct: 174 AVLLAGMVNVTTLSSKVYRQRDGTVSLYGVNSLVEASIDVSNCQMSPSG 222 >04_04_1346 + 32798825-32798900,32799027-32799070,32799163-32799256, 32799914-32799981,32800105-32800275 Length = 150 Score = 27.1 bits (57), Expect = 9.5 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Frame = -2 Query: 233 SELVEVLIGEVH-VRIRVYFSPDANYQDDQSRNGKQEIEAKHEVLYTGHSTFEGHCYSIK 57 S L+ +L H +R+ N + + R+ K E L H T +GHC S K Sbjct: 14 SLLLLLLATRAHGIRLDRQLHEAINNKQEIMRDSKAEQSLNTARLMNKHCTSDGHCNSGK 73 Query: 56 YYRQIV 39 R +V Sbjct: 74 VQRPVV 79 >04_04_0214 - 23674270-23676858,23677574-23680843,23680941-23681119, 23681200-23681559,23681645-23682086,23682199-23682332, 23682479-23682680 Length = 2391 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 335 SIPLDHIRG*TGCGHRWLHEAYGLGRFGYAQPERFH--YSISGRQE 466 S+P+D G G G L AY L + GY F +++SG E Sbjct: 17 SLPVDTRIGIVGAGPSGLSAAYALAKLGYRNVTLFEKCHTVSGMCE 62 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,699,152 Number of Sequences: 37544 Number of extensions: 272420 Number of successful extensions: 657 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -